BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0553 (607 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 29 0.047 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 23 3.1 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 5.4 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 5.4 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 7.1 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 7.1 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 21 9.4 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 9.4 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 28.7 bits (61), Expect = 0.047 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 220 MLEKSNKNSENSTVTVENGATDTLKTNN 303 +LE +NS NST+T N T+ NN Sbjct: 215 VLETCQRNSNNSTITAGNANTNASNNNN 242 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 22.6 bits (46), Expect = 3.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 141 KLKSQVCEKRHYQQFAWLDP 82 K+K++ +H Q WLDP Sbjct: 328 KVKNKKAGSKHLLQNTWLDP 347 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -1 Query: 244 YFYYFFQAS*FTKILRNSSNFI 179 YFY F + F LR SN I Sbjct: 538 YFYLFMEMDRFAVTLRPGSNSI 559 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -1 Query: 244 YFYYFFQAS*FTKILRNSSNFI 179 YFY F + F LR SN I Sbjct: 538 YFYLFMEMDRFAVTLRPGSNSI 559 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 241 NSENSTVTVENGATDTLKTNNMQVANGVSQQI 336 +SEN TVT N +K +++ A + ++I Sbjct: 132 SSENMTVTFANLGIQCVKKKDIEEALKIREEI 163 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 7.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 241 NSENSTVTVENGATDTLKTNNMQVANGVSQQI 336 +SEN TVT N +K +++ A + ++I Sbjct: 132 SSENMTVTFANLGIQCVKKKDIEEALKIREEI 163 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +3 Query: 348 TGSSSARRKLHNSNSWDVTSNFASP 422 TG + NS SW +T+N P Sbjct: 204 TGFALLVYDFRNSRSWRITNNLFYP 228 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 274 GATDTLKTNNMQVANGVSQQIY 339 G T +K NN+ + G+ +IY Sbjct: 44 GQTPLIKLNNIPKSYGIKCEIY 65 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,481 Number of Sequences: 438 Number of extensions: 3183 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17848938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -