BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0550 (535 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF007190-1|AAC02268.1| 513|Homo sapiens intestinal mucin protein. 33 0.84 AL834382-1|CAD39045.1| 505|Homo sapiens hypothetical protein pr... 32 1.1 AK055043-1|BAB70843.1| 139|Homo sapiens protein ( Homo sapiens ... 31 1.9 EF064734-1|ABK41917.1| 429|Homo sapiens Fc receptor-like 1 prot... 29 7.8 BC033690-1|AAH33690.1| 429|Homo sapiens Fc receptor-like 1 prot... 29 7.8 AY043464-1|AAK91777.1| 429|Homo sapiens Fc receptor-like protei... 29 7.8 AL833970-1|CAD38815.1| 199|Homo sapiens hypothetical protein pr... 29 7.8 AL356276-3|CAH73054.1| 429|Homo sapiens Fc receptor-like 1 prot... 29 7.8 AL356276-2|CAH73052.1| 366|Homo sapiens Fc receptor-like 1 prot... 29 7.8 AL356276-1|CAH73053.1| 428|Homo sapiens Fc receptor-like 1 prot... 29 7.8 AL139409-3|CAH70234.1| 429|Homo sapiens Fc receptor-like 1 prot... 29 7.8 AL139409-2|CAH70232.1| 366|Homo sapiens Fc receptor-like 1 prot... 29 7.8 AL139409-1|CAH70233.1| 428|Homo sapiens Fc receptor-like 1 prot... 29 7.8 AK096690-1|BAC04842.1| 366|Homo sapiens protein ( Homo sapiens ... 29 7.8 AF459634-1|AAL60250.1| 429|Homo sapiens immunoglobulin superfam... 29 7.8 AF329488-1|AAL23898.1| 428|Homo sapiens IFGP1 protein. 29 7.8 >AF007190-1|AAC02268.1| 513|Homo sapiens intestinal mucin protein. Length = 513 Score = 32.7 bits (71), Expect = 0.84 Identities = 24/93 (25%), Positives = 40/93 (43%) Frame = +1 Query: 166 TIPRDTLTGNTPKSVTAAES*EENSRTSTHVTRVGQWTTWLTRKASIRY*ATCLQSTQLT 345 T P TL ++T + E + ++ + V TT +T SI + + T Sbjct: 60 TTPLSTLVTTLLTTITRSTPTSETTYPTSPTSIVSDSTTEITYSTSITGTLSTATTLPPT 119 Query: 346 LNPLPWLKTGTSSYTPRLLKSTPNIHILMKPAF 444 + LP +T T + T L+ +TPN P+F Sbjct: 120 SSSLPTTETATMTPTTTLITTTPNTTSHSTPSF 152 >AL834382-1|CAD39045.1| 505|Homo sapiens hypothetical protein protein. Length = 505 Score = 32.3 bits (70), Expect = 1.1 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -1 Query: 409 CSSAILEYSWKCLSLAKATDSESAGCSGGTSLSIGW 302 C+S +L+ +W+C S T + SA CSG T + W Sbjct: 332 CTSRMLKLTWRCASCRTFTPTFSA-CSGATVYAASW 366 >AK055043-1|BAB70843.1| 139|Homo sapiens protein ( Homo sapiens cDNA FLJ30481 fis, clone BRAWH1000180. ). Length = 139 Score = 31.5 bits (68), Expect = 1.9 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 166 TIPRDTLTGNTPKSVTAAES*EENSRTSTHVTRVGQWTTW 285 T+PR TL G +PK + ++ + R S H+ GQ W Sbjct: 7 TVPRRTLPGQSPKPLVRSQFPLDRRRPSIHLIGQGQTLLW 46 >EF064734-1|ABK41917.1| 429|Homo sapiens Fc receptor-like 1 protein. Length = 429 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 54 THSFWCWLQA*PVATCLTSRRPRLTLHRSPTCSPILLDDSPG 179 T S+WC Q + L SRR ++ +HR P L PG Sbjct: 81 TGSYWCEAQT-MASKVLRSRRSQINVHRVPVADVSLETQPPG 121 >BC033690-1|AAH33690.1| 429|Homo sapiens Fc receptor-like 1 protein. Length = 429 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 54 THSFWCWLQA*PVATCLTSRRPRLTLHRSPTCSPILLDDSPG 179 T S+WC Q + L SRR ++ +HR P L PG Sbjct: 81 TGSYWCEAQT-MASKVLRSRRSQINVHRVPVADVSLETQPPG 121 >AY043464-1|AAK91777.1| 429|Homo sapiens Fc receptor-like protein 1 protein. Length = 429 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 54 THSFWCWLQA*PVATCLTSRRPRLTLHRSPTCSPILLDDSPG 179 T S+WC Q + L SRR ++ +HR P L PG Sbjct: 81 TGSYWCEAQT-MASKVLRSRRSQINVHRVPVADVSLETQPPG 121 >AL833970-1|CAD38815.1| 199|Homo sapiens hypothetical protein protein. Length = 199 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 54 THSFWCWLQA*PVATCLTSRRPRLTLHRSPTCSPILLDDSPG 179 T S+WC Q + L SRR ++ +HR P L PG Sbjct: 42 TGSYWCEAQT-MASKVLRSRRSQINVHRVPVADVSLETQPPG 82 >AL356276-3|CAH73054.1| 429|Homo sapiens Fc receptor-like 1 protein. Length = 429 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 54 THSFWCWLQA*PVATCLTSRRPRLTLHRSPTCSPILLDDSPG 179 T S+WC Q + L SRR ++ +HR P L PG Sbjct: 81 TGSYWCEAQT-MASKVLRSRRSQINVHRVPVADVSLETQPPG 121 >AL356276-2|CAH73052.1| 366|Homo sapiens Fc receptor-like 1 protein. Length = 366 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 54 THSFWCWLQA*PVATCLTSRRPRLTLHRSPTCSPILLDDSPG 179 T S+WC Q + L SRR ++ +HR P L PG Sbjct: 81 TGSYWCEAQT-MASKVLRSRRSQINVHRVPVADVSLETQPPG 121 >AL356276-1|CAH73053.1| 428|Homo sapiens Fc receptor-like 1 protein. Length = 428 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 54 THSFWCWLQA*PVATCLTSRRPRLTLHRSPTCSPILLDDSPG 179 T S+WC Q + L SRR ++ +HR P L PG Sbjct: 81 TGSYWCEAQT-MASKVLRSRRSQINVHRVPVADVSLETQPPG 121 >AL139409-3|CAH70234.1| 429|Homo sapiens Fc receptor-like 1 protein. Length = 429 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 54 THSFWCWLQA*PVATCLTSRRPRLTLHRSPTCSPILLDDSPG 179 T S+WC Q + L SRR ++ +HR P L PG Sbjct: 81 TGSYWCEAQT-MASKVLRSRRSQINVHRVPVADVSLETQPPG 121 >AL139409-2|CAH70232.1| 366|Homo sapiens Fc receptor-like 1 protein. Length = 366 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 54 THSFWCWLQA*PVATCLTSRRPRLTLHRSPTCSPILLDDSPG 179 T S+WC Q + L SRR ++ +HR P L PG Sbjct: 81 TGSYWCEAQT-MASKVLRSRRSQINVHRVPVADVSLETQPPG 121 >AL139409-1|CAH70233.1| 428|Homo sapiens Fc receptor-like 1 protein. Length = 428 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 54 THSFWCWLQA*PVATCLTSRRPRLTLHRSPTCSPILLDDSPG 179 T S+WC Q + L SRR ++ +HR P L PG Sbjct: 81 TGSYWCEAQT-MASKVLRSRRSQINVHRVPVADVSLETQPPG 121 >AK096690-1|BAC04842.1| 366|Homo sapiens protein ( Homo sapiens cDNA FLJ39371 fis, clone PEBLM2007598, moderately similar to Mus musculus immunoglobulin scavenger receptor IgSR mRNA. ). Length = 366 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 54 THSFWCWLQA*PVATCLTSRRPRLTLHRSPTCSPILLDDSPG 179 T S+WC Q + L SRR ++ +HR P L PG Sbjct: 81 TGSYWCEAQT-MASKVLRSRRSQINVHRVPVADVSLETQPPG 121 >AF459634-1|AAL60250.1| 429|Homo sapiens immunoglobulin superfamily receptor translocation associated 5 protein. Length = 429 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 54 THSFWCWLQA*PVATCLTSRRPRLTLHRSPTCSPILLDDSPG 179 T S+WC Q + L SRR ++ +HR P L PG Sbjct: 81 TGSYWCEAQT-MASKVLRSRRSQINVHRVPVADVSLETQPPG 121 >AF329488-1|AAL23898.1| 428|Homo sapiens IFGP1 protein. Length = 428 Score = 29.5 bits (63), Expect = 7.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 54 THSFWCWLQA*PVATCLTSRRPRLTLHRSPTCSPILLDDSPG 179 T S+WC Q + L SRR ++ +HR P L PG Sbjct: 81 TGSYWCEAQT-MASKVLRSRRSQINVHRVPVADVSLETQPPG 121 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,917,159 Number of Sequences: 237096 Number of extensions: 1862689 Number of successful extensions: 9665 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 9298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9661 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 5216942984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -