BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0549 (574 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 26 0.26 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 24 0.80 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 4.3 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 4.3 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 9.9 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 25.8 bits (54), Expect = 0.26 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -3 Query: 347 CRASTMTFWFSLVHS*QILELLTAPFYRPGCAAIESVSSFLDG 219 C + W +++ E T Y PGCA ++S S+ L G Sbjct: 356 CPTRSHAVWEMVLNELDRREDPTNDEYLPGCAMVDSCSNILTG 398 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 24.2 bits (50), Expect = 0.80 Identities = 10/28 (35%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 119 DLYAHM-GIFDNIFYFHIDIDNVHVTIW 39 D+Y+ + + DN FH+ D V++T W Sbjct: 351 DIYSDLLDLTDNNELFHLGSDEVNLTCW 378 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 4.3 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -1 Query: 370 FCFV*DPCVGPPP*RFGFRSYILN 299 FC DP PPP G Y L+ Sbjct: 127 FCHNGDPLSQPPPAHMGIPPYQLD 150 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 4.3 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -1 Query: 370 FCFV*DPCVGPPP*RFGFRSYILN 299 FC DP PPP G Y L+ Sbjct: 19 FCHNGDPLSQPPPAHMGIPPYQLD 42 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 20.6 bits (41), Expect = 9.9 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +1 Query: 322 QNVMVEALHKDLRRSKMEAILLEVDYLINDLRN 420 Q+ +E +H+ + + L EV + N +RN Sbjct: 74 QDNTIEMIHRGTFQGDIHRDLTEVYFSFNSVRN 106 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,719 Number of Sequences: 336 Number of extensions: 2835 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -