SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0549
         (574 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          24   4.0  
EF127647-1|ABL74413.1|  213|Anopheles gambiae Rab5 protein.            23   5.3  
AJ441131-8|CAD29637.1|  756|Anopheles gambiae putative 5-oxoprol...    23   9.3  
AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol...    23   9.3  

>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 23.8 bits (49), Expect = 4.0
 Identities = 9/27 (33%), Positives = 15/27 (55%)
 Frame = +3

Query: 24  TEPHVPNSDVHVIDIDMEVENIIENPH 104
           + PH PN    V + + E+ N++E  H
Sbjct: 78  SSPHAPNGTPPVDEHERELINMLEQKH 104


>EF127647-1|ABL74413.1|  213|Anopheles gambiae Rab5 protein.
          Length = 213

 Score = 23.4 bits (48), Expect = 5.3
 Identities = 10/31 (32%), Positives = 16/31 (51%)
 Frame = +3

Query: 300 LRMYERKPKRHGGGPTQGSQTKQNGSHSTRS 392
           L + ++ PK  G GP Q  +  QN ++   S
Sbjct: 179 LAIAKKLPKNEGAGPQQNIRPTQNETNRQNS 209


>AJ441131-8|CAD29637.1|  756|Anopheles gambiae putative
           5-oxoprolinase protein.
          Length = 756

 Score = 22.6 bits (46), Expect = 9.3
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -1

Query: 355 DPCVGPPP*RFGF 317
           DP  GPPP   GF
Sbjct: 314 DPAAGPPPPLIGF 326


>AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative
           5-oxoprolinase protein.
          Length = 1344

 Score = 22.6 bits (46), Expect = 9.3
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -1

Query: 355 DPCVGPPP*RFGF 317
           DP  GPPP   GF
Sbjct: 314 DPAAGPPPPLIGF 326


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 589,525
Number of Sequences: 2352
Number of extensions: 11752
Number of successful extensions: 18
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 54245403
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -