BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0548 (641 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 90 1e-18 SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) 81 6e-16 SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) 72 5e-13 SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) 68 7e-12 SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) 63 2e-10 SB_26077| Best HMM Match : UQ_con (HMM E-Value=6e-18) 56 3e-08 SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_26076| Best HMM Match : UQ_con (HMM E-Value=3.6e-15) 51 9e-07 SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) 39 0.003 SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) 38 0.007 SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) 37 0.012 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 36 0.037 SB_43379| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.049 SB_57663| Best HMM Match : UQ_con (HMM E-Value=0.24) 35 0.065 SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017) 34 0.085 SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_34490| Best HMM Match : CUB (HMM E-Value=1.3e-07) 31 1.1 SB_56714| Best HMM Match : 7tm_3 (HMM E-Value=1.6e-18) 30 1.8 SB_9360| Best HMM Match : CUB (HMM E-Value=2.5e-35) 30 1.8 SB_8042| Best HMM Match : DUF803 (HMM E-Value=0) 29 4.2 SB_19343| Best HMM Match : tRNA-synt_1e (HMM E-Value=0) 29 4.2 SB_48646| Best HMM Match : Sulfotransfer_1 (HMM E-Value=8.5) 28 5.6 SB_9616| Best HMM Match : PTS_IIB_fruc (HMM E-Value=2.3) 28 5.6 SB_59414| Best HMM Match : Complex1_LYR (HMM E-Value=7.7) 28 7.4 SB_28044| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_39170| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_35256| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_11112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 SB_49983| Best HMM Match : Cyt-b5 (HMM E-Value=8.4e-12) 27 9.8 SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4) 27 9.8 SB_24728| Best HMM Match : Oxidored_q4 (HMM E-Value=8.5) 27 9.8 SB_3750| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.8 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 90.2 bits (214), Expect = 1e-18 Identities = 47/117 (40%), Positives = 62/117 (52%), Gaps = 11/117 (9%) Frame = +1 Query: 250 PDGSLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGT 429 PD S N W+ AI G GT + GG +K M F DYP SPP +F ++HPN+Y SG Sbjct: 1149 PDES-NTFEWDVAIFGPPGTLYAGGYFKAHMSFPHDYPYSPPTFRFLTKMWHPNIYESGD 1207 Query: 430 VCLSLLDEEKD-----------WRPAITIKQILLGIQDLLNEPNVKDPAQAEAYTIY 567 VC+S+L D W P ++ ILL + LLNEPN PA +A ++ Sbjct: 1208 VCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMF 1264 >SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 81.8 bits (193), Expect = 4e-16 Identities = 39/108 (36%), Positives = 60/108 (55%), Gaps = 11/108 (10%) Frame = +1 Query: 265 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 444 +L WE + G GT +E G +K M+F +YP PP F ++HPNV+ +G VC+S+ Sbjct: 361 DLYKWEIMVVGPPGTYYEEGYFKASMVFPKEYPQRPPTLTFISDIWHPNVHKNGEVCISI 420 Query: 445 LDE-----------EKDWRPAITIKQILLGIQDLLNEPNVKDPAQAEA 555 L E ++ WRP T++ I+L + +L EPN + PA +A Sbjct: 421 LHEPGEDKYGYEKADERWRPIHTVETIMLSVISMLAEPNDESPANVDA 468 >SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) Length = 190 Score = 81.4 bits (192), Expect = 6e-16 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 2/100 (2%) Frame = +1 Query: 295 GKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSLL--DEEKDWR 468 G +GTP+ G++KL + + YP PPK +F P++HPN+ SG +CL L + W+ Sbjct: 4 GAEGTPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWK 63 Query: 469 PAITIKQILLGIQDLLNEPNVKDPAQAEAYTIYCQNRLEY 588 PA+ I +L I L+ EPN DP AE + N+ ++ Sbjct: 64 PALNISSVLSTILILMAEPNPDDPLMAEISNEFKYNKAQF 103 >SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) Length = 145 Score = 71.7 bits (168), Expect = 5e-13 Identities = 30/110 (27%), Positives = 63/110 (57%) Frame = +1 Query: 265 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 444 N++ W+ I + P+ G +++ + F +YP PPK F+ ++HPN+ G VCL + Sbjct: 22 NILYWQGLIVPEM-PPYNKGAFRIEICFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPI 80 Query: 445 LDEEKDWRPAITIKQILLGIQDLLNEPNVKDPAQAEAYTIYCQNRLEYDK 594 + E +W+PA +Q++ + L+++P + P +A+ Y +++ ++ K Sbjct: 81 ISPE-NWKPATKTEQVIQALLALVHDPEPEHPLRADLAEEYSKDKKKFMK 129 >SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 226 Score = 67.7 bits (158), Expect = 7e-12 Identities = 42/114 (36%), Positives = 56/114 (49%) Frame = +1 Query: 250 PDGSLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGT 429 P G +L W I G G+ +EGG++ L + F DYP PPK G Sbjct: 119 PKGD-DLYEWYSTILGPPGSVYEGGVFFLDIHFPSDYPFKPPK---------------GM 162 Query: 430 VCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNVKDPAQAEAYTIYCQNRLEYD 591 VCL +L + W PA+TI ++LL I LL + N DP +Y QNR E+D Sbjct: 163 VCLDILKDS--WSPALTISKVLLSICSLLTDCNPADPLVGSIAALYVQNRSEHD 214 >SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) Length = 204 Score = 62.9 bits (146), Expect = 2e-10 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 2/78 (2%) Frame = +1 Query: 361 PSSPPKCKFEPPLFHPNVYPSGTVCLSLL--DEEKDWRPAITIKQILLGIQDLLNEPNVK 534 P PPK +F P++HPN+ SG +CL L + W+PA+ I +L I L+ EPN Sbjct: 40 PFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWKPALNISSVLSTILILMAEPNPD 99 Query: 535 DPAQAEAYTIYCQNRLEY 588 DP AE + N+ ++ Sbjct: 100 DPLMAEISNEFKYNKAQF 117 >SB_26077| Best HMM Match : UQ_con (HMM E-Value=6e-18) Length = 215 Score = 55.6 bits (128), Expect = 3e-08 Identities = 31/93 (33%), Positives = 52/93 (55%), Gaps = 1/93 (1%) Frame = +1 Query: 265 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNV-YPSGTVCLS 441 N+ +E I G + GG +K + +DYP++PP + ++HPN+ G+VCLS Sbjct: 35 NMEEFELQITPTDGA-YRGGQFKFS-VKTEDYPNTPPVPRCVNNIYHPNMDLDDGSVCLS 92 Query: 442 LLDEEKDWRPAITIKQILLGIQDLLNEPNVKDP 540 LLD DW + ++ ++ G+ L PN++DP Sbjct: 93 LLD---DWNESNDLEDLVQGLLFLFYNPNLEDP 122 >SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 53.2 bits (122), Expect = 2e-07 Identities = 26/70 (37%), Positives = 41/70 (58%) Frame = +1 Query: 385 FEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNVKDPAQAEAYTI 564 F +FHPNV +G +C++ L +KDW+P + IKQ+LL ++ LL PN + EA + Sbjct: 147 FLTKIFHPNVAKNGEICVNTL--KKDWKPDLGIKQVLLTVKCLLIVPNPESALNEEAGKL 204 Query: 565 YCQNRLEYDK 594 + +Y K Sbjct: 205 LLERYDDYSK 214 >SB_26076| Best HMM Match : UQ_con (HMM E-Value=3.6e-15) Length = 243 Score = 50.8 bits (116), Expect = 9e-07 Identities = 28/92 (30%), Positives = 48/92 (52%) Frame = +1 Query: 265 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL 444 N+ +E I G + GG +K + DYP+ P + ++HPN+ VC+SL Sbjct: 35 NMEEFELQITPTDGA-YRGGQFKFS-VRTTDYPNVAPSINCKTKIYHPNMDGYDGVCMSL 92 Query: 445 LDEEKDWRPAITIKQILLGIQDLLNEPNVKDP 540 LD DW+ + ++ ++ G+ L PN++DP Sbjct: 93 LD---DWQASNDLEDLVQGLLFLFYNPNLEDP 121 >SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 47.2 bits (107), Expect = 1e-05 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 7/91 (7%) Frame = +1 Query: 289 IPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPP-----LFHPNVYPSGTVCLSLLDE 453 I G TP+EGG + + DYP PP+ K F+PN+Y +G VCLS++ + Sbjct: 17 ITGPFDTPYEGGFFYFLIRCPPDYPIRPPRVKLMTTGSGQVRFNPNLYRNGKVCLSIIGD 76 Query: 454 --EKDWRPAITIKQILLGIQDLLNEPNVKDP 540 EK + ++ + LN N++DP Sbjct: 77 VMEKSFPEFYDYYISVITEKSYLNGQNMQDP 107 >SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 385 Score = 43.6 bits (98), Expect = 1e-04 Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 1/113 (0%) Frame = +1 Query: 169 ASARLAEERKAWRKDHPFGFVARPMKNPDGSLNLMTWECAIPGKKGTPWEGGLYKLRMIF 348 A RL E K R + A+P+++ NL W + G T + GG Y R+I Sbjct: 11 AVKRLMREAKELRNATEL-YHAQPLED-----NLFEWHFTVRGPPDTEFAGGRYHGRIIL 64 Query: 349 KDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSL-LDEEKDWRPAITIKQILLGI 504 +YP PP P + +CLS+ + W+P+ +I+ +L+ I Sbjct: 65 PPEYPMKPPSIMLLTP--NGRFEIGKKICLSMSAHHPETWQPSWSIRTVLMAI 115 >SB_26761| Best HMM Match : UQ_con (HMM E-Value=1.7e-06) Length = 739 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 289 IPGKKGTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPL---FHPNVYPSGTVCLS 441 I G GTP++ GL+ ++ +YP +PP + +PN+Y G VC++ Sbjct: 640 IEGPAGTPYDHGLFAFDILLPANYPDAPPSFHYLSMCNGRLNPNLYEDGKVCIT 693 >SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) Length = 200 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +1 Query: 250 PDGSLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPK 378 P G +L W I G G+ +EGG++ L + F DYP PPK Sbjct: 159 PKGD-DLYEWYSTILGPPGSVYEGGVFFLDIHFPSDYPFKPPK 200 >SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) Length = 181 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = +1 Query: 250 PDGSLNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPPK 378 P G L W I G G+ +EGG++ L + F DYP PPK Sbjct: 46 PKGD-KLYEWYSTILGPPGSVYEGGVFFLDIHFPTDYPFKPPK 87 >SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) Length = 841 Score = 35.5 bits (78), Expect = 0.037 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 289 IPGKKGTPWEGGLYKLRMIFKDDYPSSPPK 378 I G TP+EGG Y L ++ + YP +PPK Sbjct: 693 IRGPPETPFEGGTYNLDIVIPETYPFNPPK 722 >SB_43379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3066 Score = 35.1 bits (77), Expect = 0.049 Identities = 15/52 (28%), Positives = 29/52 (55%) Frame = -2 Query: 274 SLNSMNHLDSS*ASRQNQRDGPYAKLSVLQLNVHLLSLTFSTKITRFMSRAS 119 +L + L S S++N+ D P L++ LN HL ++ ++T+FM + + Sbjct: 2865 ALTGSSRLRSPSGSKRNKEDSPNVPLTLSDLNNHLNTINLQVEVTKFMHKCA 2916 >SB_57663| Best HMM Match : UQ_con (HMM E-Value=0.24) Length = 48 Score = 34.7 bits (76), Expect = 0.065 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 Query: 463 WRPAITIKQILLGIQDLLNEPNVKDP 540 W PA+ I+ +LL IQ LL+ PN DP Sbjct: 3 WSPALQIRTVLLSIQALLSAPNPDDP 28 >SB_3717| Best HMM Match : UQ_con (HMM E-Value=0.00017) Length = 123 Score = 34.3 bits (75), Expect = 0.085 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 265 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDYPSSPP 375 NL W + G T + GG Y R+I +YP PP Sbjct: 2 NLFEWHFTVRGPPDTEFAGGRYHGRIILPPEYPMKPP 38 >SB_30411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 32.3 bits (70), Expect = 0.34 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 295 GKKGTPWEGGLYKLRMIFKDDYPSSPP 375 G GTP+EGG++K+R+ + YP P Sbjct: 56 GPVGTPYEGGVWKVRVDLPEKYPFKSP 82 >SB_26178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 31.9 bits (69), Expect = 0.46 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +1 Query: 334 LRMIFKDDYPSSPPKCKFEPPLFHPN-VYPSGTVCLSLLDEEKDWRPAITIKQILL 498 L + F +++P +PP + P V G +C+ LL K W A T++ ++L Sbjct: 793 LNITFPENFPFAPPFMRVLAPRIEGGFVLDGGAICMELL-TPKGWSSAYTVEAVVL 847 >SB_34490| Best HMM Match : CUB (HMM E-Value=1.3e-07) Length = 242 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = +1 Query: 403 HPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNVKDPAQAEAYTIY 567 +PN YP+ C + + + ITI L + D L+ NVK AE Y Sbjct: 159 YPNSYPNNMDCRWTIIVQAGFIVRITIAVFELAVNDFLHTSNVKSAQAAEGNKTY 213 >SB_56714| Best HMM Match : 7tm_3 (HMM E-Value=1.6e-18) Length = 484 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 373 PKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLL 516 P C P +PNV + TVC+ L E DW ++ + L I +L Sbjct: 165 PNCTMCPIKQYPNV--NRTVCIDLPLENLDWTSLVSASMLALAITAML 210 >SB_9360| Best HMM Match : CUB (HMM E-Value=2.5e-35) Length = 275 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = +1 Query: 403 HPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNVKDPAQAEAYTIY 567 +PN YP+ C + + + IT+ L + D L+ NVK AE Y Sbjct: 192 YPNSYPNNMDCRWTIIVQAGFIVRITVAVFELAVNDFLHMSNVKSTQAAEGNKTY 246 >SB_8042| Best HMM Match : DUF803 (HMM E-Value=0) Length = 603 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +2 Query: 299 KRGLHGKVGCI-NYV*SSKMIIHQVLQNA 382 K+ LHGKVGCI + + S+ ++IH + A Sbjct: 350 KQNLHGKVGCILSIIGSTVLVIHAPQEEA 378 >SB_19343| Best HMM Match : tRNA-synt_1e (HMM E-Value=0) Length = 583 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 457 KDWRPAITIKQILLGIQDLLNEPNVKDP 540 K + ITIK L ++D+L +P VK P Sbjct: 377 KSLKNFITIKDFFLAVKDILRKPEVKAP 404 >SB_48646| Best HMM Match : Sulfotransfer_1 (HMM E-Value=8.5) Length = 674 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 355 DYPSSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAI 477 D + P C F +F +P V LS+ D+E+ WR ++ Sbjct: 60 DATTDAPACFFYKEIFR--AFPYAKVILSVRDDEESWRRSL 98 >SB_9616| Best HMM Match : PTS_IIB_fruc (HMM E-Value=2.3) Length = 462 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = -1 Query: 527 LGSLRRS*IPNKICFIVIAGRQSFSSSSSDKHTVPDG 417 LGSL + +P++I + AGR++F +S+ K VP G Sbjct: 69 LGSLAKGLVPSEIRDLANAGRETFEAST--KGLVPSG 103 >SB_59414| Best HMM Match : Complex1_LYR (HMM E-Value=7.7) Length = 350 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 355 DYPSSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWR 468 D + P C F +F +P V LS+ D+E+ WR Sbjct: 60 DATTDLPACIFYKEIF--KAFPDAKVILSVRDDEESWR 95 >SB_28044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 27.9 bits (59), Expect = 7.4 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 3/84 (3%) Frame = -1 Query: 380 HFGGLDG*SSLKIIRSLYSPPSHGVPFLPGIA-HSQVIKFNE--PSGFFIGLATKPKGWS 210 H + G +L + +L P+H G+ H + FN P F G+ + Sbjct: 506 HVKIMSGPKALPAVYTLARTPTHSRIIARGVMNHIETDLFNGLIPQCFVFGMLYQDTS-- 563 Query: 209 LRQAFRSSAKRALAIPDIFYKNNS 138 Q +RS+ K++ I ++YKN + Sbjct: 564 --QLYRSTPKKSYLIKSLYYKNKA 585 >SB_39170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 307 TPWEGGLYKLRMIFKDDYPSSPPKCKF 387 T +E +Y L+++ +YP PP KF Sbjct: 1 TVFENRIYNLKIVCGPNYPQKPPTVKF 27 >SB_35256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 307 TPWEGGLYKLRMIFKDDYPSSPPKCKF 387 T +E +Y L+++ +YP PP KF Sbjct: 1 TVFENRIYNLKIVCGPNYPQKPPTVKF 27 >SB_11112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 27.5 bits (58), Expect = 9.8 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 4/67 (5%) Frame = +1 Query: 184 AEERKAWRKDHP-FGFVARPMKNPDGSLNLMTWECAIPG---KKGTPWEGGLYKLRMIFK 351 +E+++ R+D P FGF P KNP ++ A+P + TP + Y+ + Sbjct: 164 SEKKRRKRRDGPLFGFRTPPKKNPGYCPMYSLFKAALPAGCTGESTPSQQAPYQSTPSQR 223 Query: 352 DDYPSSP 372 Y S+P Sbjct: 224 APYQSTP 230 >SB_49983| Best HMM Match : Cyt-b5 (HMM E-Value=8.4e-12) Length = 303 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 514 LNEPNVKDPAQAEAYTIYC 570 L++P +DP + AYTIYC Sbjct: 246 LDDPYSRDPKRHPAYTIYC 264 >SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 352 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -2 Query: 211 PYAKLSVLQLNVHLLSLTFSTKITRFMSRASIKGYS*CWAID 86 P LSV L +HLL++ + R SR+ ++ Y C +D Sbjct: 10 PPTMLSVGSLVIHLLTVLMGYQSERHQSRSGLQRYRDCKKLD 51 >SB_24728| Best HMM Match : Oxidored_q4 (HMM E-Value=8.5) Length = 121 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 Query: 420 WIHIGVEQWWFKFAFWRT 367 W H WWFKF F RT Sbjct: 64 WSHKWGRGWWFKFLFIRT 81 >SB_3750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/53 (22%), Positives = 25/53 (47%) Frame = +1 Query: 166 IASARLAEERKAWRKDHPFGFVARPMKNPDGSLNLMTWECAIPGKKGTPWEGG 324 + + + A+E + W + +G+ + + SL + E +P K W+GG Sbjct: 37 VVTHKSAKESRRWLSEPSYGYWPQQLNFAGISLERLCIEFGLPRKPDFRWKGG 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,208,578 Number of Sequences: 59808 Number of extensions: 416166 Number of successful extensions: 1007 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 993 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -