BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0544 (621 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59638| Best HMM Match : HNF-1_N (HMM E-Value=0) 30 1.7 SB_6042| Best HMM Match : HEAT (HMM E-Value=0.3) 29 4.0 >SB_59638| Best HMM Match : HNF-1_N (HMM E-Value=0) Length = 808 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 168 VPVPHDIPQAPGKPEENAT 224 +P PH I QA G+PE AT Sbjct: 371 IPTPHGITQAQGRPENTAT 389 >SB_6042| Best HMM Match : HEAT (HMM E-Value=0.3) Length = 168 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +1 Query: 139 NSLEPNWELQYPFLMISLK--LQVNLKKTQQQFSLRNKTQL 255 N + NWELQ+ L++SLK L++ + T + S ++ QL Sbjct: 79 NKQQINWELQWRRLLLSLKQSLEMLYEDTSEHSSSESRVQL 119 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,395,478 Number of Sequences: 59808 Number of extensions: 244944 Number of successful extensions: 638 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -