BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0544 (621 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27430.1 68418.m03274 signal peptidase subunit family protein... 28 4.3 At2g02490.1 68415.m00188 hydroxyproline-rich glycoprotein family... 28 4.3 At3g15970.1 68416.m02019 Ran-binding protein 1 domain-containing... 27 7.6 >At5g27430.1 68418.m03274 signal peptidase subunit family protein contains Pfam profile: PF04573 signal peptidase subunit Length = 167 Score = 28.3 bits (60), Expect = 4.3 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 567 IWQVLISEWSHPLFWLQLKSLFHFF*Q 487 +W +I E H FW+Q+ + + F Q Sbjct: 100 LWDAIIPEKEHAKFWIQISNKYRFIDQ 126 >At2g02490.1 68415.m00188 hydroxyproline-rich glycoprotein family protein related to LENOD2 [Lupinus luteus] gi|296830|emb|CAA39050; and genefinder Length = 302 Score = 28.3 bits (60), Expect = 4.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +3 Query: 135 AEQSGAQLGTTVPVPHDIPQAPGKPEENATAV 230 A+ S Q + P+PH +P +PG P T + Sbjct: 66 AKISVNQYPSVFPIPHPVPPSPGHPPHQNTKI 97 >At3g15970.1 68416.m02019 Ran-binding protein 1 domain-containing protein / RanBP1 domain-containing protein similar to Ran binding protein [Homo sapiens] GI:624232; contains Pfam profile PF00638: RanBP1 domain Length = 465 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 373 ACSSGFTEAGTDDADTGVASVTFSASGFTF 284 A SS + + +A TG+AS FSAS F+F Sbjct: 237 ALSSFHQHSSSKNAFTGLASTGFSASSFSF 266 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,675,762 Number of Sequences: 28952 Number of extensions: 173731 Number of successful extensions: 453 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -