BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0543 (615 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces p... 28 1.2 SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual 26 5.0 SPBC3E7.05c |||conserved eukaryotic protein|Schizosaccharomyces ... 26 5.0 SPCC962.05 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||... 25 8.7 >SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 309 Score = 27.9 bits (59), Expect = 1.2 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 377 DAVSGIGTDEEAIIEILCTLSNYGIRTISAFYEQLYGKSLESD 505 DA++ + +E I E T +Y IRT+S Y+ Y S D Sbjct: 215 DAITSLWDPQELICERSITRMDYPIRTLSFSYDSRYLASGSED 257 >SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual Length = 1339 Score = 25.8 bits (54), Expect = 5.0 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 466 ILRTTVRQEPGIGLKRRHVG 525 ++ T + +PG LK+RH+G Sbjct: 1171 MMPTNIEHDPGCTLKKRHIG 1190 >SPBC3E7.05c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 25.8 bits (54), Expect = 5.0 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Frame = +1 Query: 457 HIRILRTTVRQEPGIGLKR-----RHVGTLQEIVRVVVHGQSR 570 H++ ++ V QE G L R LQE+VRVV+H R Sbjct: 325 HLQSIKAQVEQERGSRLGRLQELRNSFQQLQELVRVVLHENGR 367 >SPCC962.05 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 536 Score = 25.0 bits (52), Expect = 8.7 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = -3 Query: 85 VLLSAHVEILLFNSDTPNHTLVPI 14 V+LS + LL++ DTP++ +P+ Sbjct: 164 VILSQDSDFLLYDIDTPHYGYIPL 187 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,306,160 Number of Sequences: 5004 Number of extensions: 42648 Number of successful extensions: 137 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -