BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0541 (615 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61620.1 68414.m06943 expressed protein contains Pfam profile... 97 8e-21 At3g07370.1 68416.m00879 tetratricopeptide repeat (TPR)-containi... 43 2e-04 At5g67530.1 68418.m08515 peptidyl-prolyl cis-trans isomerase cyc... 33 0.20 At3g52450.1 68416.m05768 U-box domain-containing protein similar... 32 0.26 At1g76390.1 68414.m08877 armadillo/beta-catenin repeat family pr... 32 0.26 At5g61560.1 68418.m07725 protein kinase family protein contains ... 30 1.1 At3g20010.1 68416.m02531 SNF2 domain-containing protein / helica... 30 1.1 At5g01830.1 68418.m00102 armadillo/beta-catenin repeat family pr... 30 1.4 At4g28270.1 68417.m04049 zinc finger (C3HC4-type RING finger) fa... 30 1.4 At1g11670.1 68414.m01340 MATE efflux family protein similar to r... 29 3.2 At1g61890.1 68414.m06982 MATE efflux family protein similar to r... 28 4.3 At5g61550.1 68418.m07724 protein kinase family protein contains ... 28 5.7 At5g60150.1 68418.m07540 expressed protein ; expression supporte... 28 5.7 At3g43390.1 68416.m04592 hypothetical protein similar to At3g243... 28 5.7 At1g67510.1 68414.m07690 leucine-rich repeat family protein cont... 28 5.7 At4g21350.1 68417.m03084 U-box domain-containing protein similar... 27 7.5 At1g20780.1 68414.m02602 armadillo/beta-catenin repeat protein-r... 27 7.5 At3g42630.1 68416.m04430 pentatricopeptide (PPR) repeat-containi... 27 9.9 At1g68940.1 68414.m07891 armadillo/beta-catenin repeat protein-r... 27 9.9 >At1g61620.1 68414.m06943 expressed protein contains Pfam profile: PF01363 FYVE zinc finger Length = 310 Score = 97.1 bits (231), Expect = 8e-21 Identities = 60/189 (31%), Positives = 95/189 (50%), Gaps = 6/189 (3%) Frame = +3 Query: 66 RHARNCTAGAVYTYHEKKKDAAASGYGTQSERVGKDSIKNFDCCSLTLQPCRNPVVTKEG 245 RH++N A +TY EKKK GYGTQ ER+G+DSIK FD CSL L+P +P+ +G Sbjct: 4 RHSKNNNDLAYFTYDEKKK----LGYGTQRERLGRDSIKPFDACSLCLKPFIDPMCCHKG 59 Query: 246 YLFDKEAILEYIISKKNAYNRLLKKYEKQLKKDXXXXXXXXXXXXXXXXIKFMNREKNIS 425 ++F +E ILE +++K R L + Q K+D +F + + Sbjct: 60 HVFCRECILECFLAQKKDIQRRLAAHSSQKKQDKDEEEERLMLQKARELDEFDQQNHSAM 119 Query: 426 STTPSTSAIEEKT----INSVSNIANGKE--KQLPSFWVPSQLPDAKISKIEKPDPTVYC 587 + E+K NSV + +E + + +FW+PS P A + +++ P+ C Sbjct: 120 PRNSDKNHNEDKNGFHGANSVKTTSFEEEALRTMKAFWLPSATPAASV-RVDAPETHTVC 178 Query: 588 PISGKPLKM 614 P + LK+ Sbjct: 179 PEGKEKLKL 187 >At3g07370.1 68416.m00879 tetratricopeptide repeat (TPR)-containing protein / U-box domain-containing protein similar to serologically defined colon cancer antigen 7 GB:5031963 GI:3170178 [Homo sapiens]; Length = 278 Score = 42.7 bits (96), Expect = 2e-04 Identities = 21/80 (26%), Positives = 43/80 (53%) Frame = +3 Query: 42 KQTVLKMTRHARNCTAGAVYTYHEKKKDAAASGYGTQSERVGKDSIKNFDCCSLTLQPCR 221 +Q L M+R + + YT H ++ A + +E + ++ CC++TL+ R Sbjct: 157 QQRALDMSRTEES--SDEAYTAHTERLKALERVFKKAAEEDKPTEVPDYLCCNITLEIFR 214 Query: 222 NPVVTKEGYLFDKEAILEYI 281 +PV++ G +++ AILE++ Sbjct: 215 DPVISPSGVTYERAAILEHL 234 >At5g67530.1 68418.m08515 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein contains Pfam domain, PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 595 Score = 32.7 bits (71), Expect = 0.20 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +3 Query: 132 ASGYGTQSERVGKDSIKN--FDCCSLTLQPCRNPVVTKEGYLFDKEAILEYI 281 A+ +G + + K+ + CC+LT P +PV T +G +F+ I+ YI Sbjct: 19 ATEWGGAKSKENRTPFKSLPYYCCALTFLPFEDPVCTIDGSVFEITTIVPYI 70 >At3g52450.1 68416.m05768 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain Length = 435 Score = 32.3 bits (70), Expect = 0.26 Identities = 14/42 (33%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +3 Query: 177 IKNFDCCSLTLQPCRNPVVTKEGYLFDKEAILEYIIS-KKNA 299 I +F C ++L ++PV+ G +D+E+I +++ S KKN+ Sbjct: 7 IPSFFLCPISLDIMKDPVIVSTGITYDRESIEKWLFSGKKNS 48 >At1g76390.1 68414.m08877 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 811 Score = 32.3 bits (70), Expect = 0.26 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +3 Query: 123 DAAASGYGTQSERVGKDSIKNFDCCSLTLQPCRNPVVTKEGYLFDKEAI 269 D + S +Q E G D+I C LT Q NPV + G F++EAI Sbjct: 8 DGSQSDNSSQFEP-GIDNIYEAFICPLTKQVMHNPVTLENGQTFEREAI 55 >At5g61560.1 68418.m07725 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 796 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 195 CSLTLQPCRNPVVTKEGYLFDKEAILEYI 281 C +T NP V +GY ++K AI E++ Sbjct: 731 CPITKDVMENPCVASDGYTYEKRAIKEWL 759 >At3g20010.1 68416.m02531 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to transcription factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 1047 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +3 Query: 210 QPCRNPVVTKEGYLFDKEAILEYIISKKNAYNRLLKKYEKQLKKD 344 +P PVVT G++F E +LEYI +N + + ++QL +D Sbjct: 756 EPPEKPVVTLCGHIFCYECVLEYITGDENTCP--VPRCKQQLARD 798 >At5g01830.1 68418.m00102 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 674 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +3 Query: 195 CSLTLQPCRNPVVTKEGYLFDKEAILEYIISKKN 296 C +TL+ R+PVV G +D+E+I +I S N Sbjct: 280 CPITLELMRDPVVVATGQTYDRESIDLWIQSGHN 313 >At4g28270.1 68417.m04049 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 193 Score = 29.9 bits (64), Expect = 1.4 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +3 Query: 171 DSIKNFDCCSLTLQPCRNPVVTKEGYLFDKEAILEYIISKKNAYNRL 311 DS +FDC ++ L R+PVVT G+LF I ++ + N+ R+ Sbjct: 14 DSGGDFDC-NICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRV 59 >At1g11670.1 68414.m01340 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family; EST gb|W43487 comes from this gene Length = 503 Score = 28.7 bits (61), Expect = 3.2 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 511 LVFGYHPNFPMQRFRK*KNLIQPFTVRSAA 600 ++F Y NFP+Q+F + ++++ P SAA Sbjct: 180 MIFAYAVNFPIQKFLQSQSIVTPSAYISAA 209 >At1g61890.1 68414.m06982 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 501 Score = 28.3 bits (60), Expect = 4.3 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 511 LVFGYHPNFPMQRFRK*KNLIQPFTVRSAA 600 ++F Y NFP+Q+F + ++++ P SAA Sbjct: 177 VIFAYAVNFPIQKFLQSQSIVTPSAYISAA 206 >At5g61550.1 68418.m07724 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain; protein kinase 1, PnPK1, Populus nigra, EMBL:AB041503 Length = 845 Score = 27.9 bits (59), Expect = 5.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 195 CSLTLQPCRNPVVTKEGYLFDKEAILEYIISK 290 C L P V +GY +D+EAI E++ K Sbjct: 781 CPLLKGVMNEPCVAADGYTYDREAIEEWLRQK 812 >At5g60150.1 68418.m07540 expressed protein ; expression supported by MPSS Length = 1195 Score = 27.9 bits (59), Expect = 5.7 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +3 Query: 426 STTPSTSAIEEKTINSVSNIANGKEKQLPSFWVPSQLPDAKISKIEKPDP 575 + +P A+EE N + + +EK+L S +P +L +K+ K DP Sbjct: 164 NVSPGLQALEENLFNDLPVNSKNREKKLVSGIMPKELSISKV-PTTKSDP 212 >At3g43390.1 68416.m04592 hypothetical protein similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300 Length = 1113 Score = 27.9 bits (59), Expect = 5.7 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 426 STTPSTSAIEEKTINSVSNIANGKEKQ 506 S PSTSA EE S S +ANG E + Sbjct: 724 SGLPSTSAQEEARDASASTVANGSESE 750 >At1g67510.1 68414.m07690 leucine-rich repeat family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 719 Score = 27.9 bits (59), Expect = 5.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 96 VYTYHEKKKDAAASGYGTQSERVGKDSIKNFDCCSLT 206 VY Y KKKD+ T + ++G S+K CC +T Sbjct: 335 VYLYW-KKKDSEGGCSCTGNAKLGGGSVKGKSCCCIT 370 >At4g21350.1 68417.m03084 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582198; contains Pfam profile PF04564: U-box domain Length = 374 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/31 (32%), Positives = 21/31 (67%) Frame = +3 Query: 195 CSLTLQPCRNPVVTKEGYLFDKEAILEYIIS 287 C ++L+ +PV+ + G+ FD+ +I ++I S Sbjct: 11 CPISLEIMSDPVILQSGHTFDRVSIQQWIDS 41 >At1g20780.1 68414.m02602 armadillo/beta-catenin repeat protein-related / U-box domain-containing protein low similarity to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain Length = 801 Score = 27.5 bits (58), Expect = 7.5 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +3 Query: 123 DAAASGYGTQSERVGKDSIKNFDCCSLTLQPCRNPVVTKEGYLFDKEAI 269 D S + ER G D I C LT + +PV + G F++EAI Sbjct: 6 DGDQSDDSSHFER-GVDHIYEAFICPLTKEVMHDPVTLENGRTFEREAI 53 >At3g42630.1 68416.m04430 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 415 Score = 27.1 bits (57), Expect = 9.9 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +3 Query: 183 NFDCCSLTL-QPCRNPVVTKEGYLFDKEAILEYIISKKNAYNRLLKKY-EKQLKKD 344 N D L L P V+ K + EA+LE+ K Y +L+ Y +K+L++D Sbjct: 354 NLDDSPLVLTDPLAFEVLGKGDFHLSSEAVLEFSPRKNWTYRKLIGVYLKKKLRRD 409 >At1g68940.1 68414.m07891 armadillo/beta-catenin repeat protein-related / U-box domain-containing protein ; contains Pfam profile PF04564: U-box domain Length = 1033 Score = 27.1 bits (57), Expect = 9.9 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 195 CSLTLQPCRNPVVTKEGYLFDKEAILEYIISKKNA 299 C LT + +PV T+ G +++A++E+ S N+ Sbjct: 252 CPLTKEIMEDPVTTETGVTCERQAVIEWFDSFGNS 286 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,059,850 Number of Sequences: 28952 Number of extensions: 224531 Number of successful extensions: 657 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 655 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -