Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0538
         (525 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292362-1|CAL23174.2|  398|Tribolium castaneum gustatory recept...    22   3.8  
DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory pro...    21   5.0  
DQ855493-1|ABH88180.1|  127|Tribolium castaneum chemosensory pro...    21   8.8  

>AM292362-1|CAL23174.2|  398|Tribolium castaneum gustatory receptor
           candidate 41 protein.
          Length = 398

 Score = 21.8 bits (44), Expect = 3.8
 Identities = 10/17 (58%), Positives = 11/17 (64%)
 Frame = -2

Query: 104 CVEVHNGHLILRTPNIC 54
           C+   N  LI RTPNIC
Sbjct: 310 CMSASN--LIQRTPNIC 324


>DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory
           protein 17 protein.
          Length = 124

 Score = 21.4 bits (43), Expect = 5.0
 Identities = 10/36 (27%), Positives = 20/36 (55%), Gaps = 2/36 (5%)
 Frame = +1

Query: 412 AKLYGRELSTYDEVDVDELL--SKLTQEELTMLAKE 513
           A +Y  E +    +D+DE+L   +LT+  L  + ++
Sbjct: 14  AYVYAEEYTVPQNIDIDEILKNDRLTKNYLDCILEK 49


>DQ855493-1|ABH88180.1|  127|Tribolium castaneum chemosensory
           protein 7 protein.
          Length = 127

 Score = 20.6 bits (41), Expect = 8.8
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = +1

Query: 442 YDEVDVDELLS 474
           YD VDVD++L+
Sbjct: 27  YDNVDVDKILN 37


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 112,468
Number of Sequences: 336
Number of extensions: 2168
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12678017
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)