BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0538 (525 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 27 0.51 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 1.6 AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. 23 4.7 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 6.3 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 26.6 bits (56), Expect = 0.51 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = -3 Query: 202 RHIH*NFHV*GTSSISRFFFNSIYMS*FGTEVIALKCTMVT*FCEHQIFAC 50 RH NFH+ S FF + + F ++CT V EH +F C Sbjct: 932 RHGEVNFHLSQVLSGHGFFRDDLCRMGFTPSPDCIRCTGVPETAEHAMFEC 982 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.0 bits (52), Expect = 1.6 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 336 HHHNHYKDPNYPKIILNKD 392 HHH+H+++PN + N D Sbjct: 659 HHHHHHQNPNDHFVNTNTD 677 >AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. Length = 144 Score = 23.4 bits (48), Expect = 4.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 60 IWCSQNQVTIVHFNAMTSVPNYDI 131 + CS N + I + A SVP Y++ Sbjct: 117 VQCSHNCIYIPYGGAEVSVPTYEV 140 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.0 bits (47), Expect = 6.3 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -2 Query: 89 NGHLILRTPN 60 NGHLILRT N Sbjct: 1051 NGHLILRTTN 1060 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 500,758 Number of Sequences: 2352 Number of extensions: 9666 Number of successful extensions: 23 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48205926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -