BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0538 (525 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97193-8|AAB52440.3| 392|Caenorhabditis elegans Tropomodulin pr... 32 0.29 Z69885-4|CAA93757.1| 208|Caenorhabditis elegans Hypothetical pr... 29 2.0 >U97193-8|AAB52440.3| 392|Caenorhabditis elegans Tropomodulin protein 1, isoform a protein. Length = 392 Score = 31.9 bits (69), Expect = 0.29 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 412 AKLYGRELSTYDEVDVDELLSKLTQEELTMLAKEVDPD 525 +K+Y + L ++ D++ LLS L+ +EL L + DPD Sbjct: 30 SKVYNKGLKDLEDNDIEGLLSSLSIDELEDLNNDFDPD 67 >Z69885-4|CAA93757.1| 208|Caenorhabditis elegans Hypothetical protein T04C10.4 protein. Length = 208 Score = 29.1 bits (62), Expect = 2.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 333 DHHHNHYKDPNYPKIILN 386 +HHH+H++ P YP+ N Sbjct: 29 NHHHHHHQSPTYPQSYFN 46 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,905,180 Number of Sequences: 27780 Number of extensions: 204238 Number of successful extensions: 496 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 496 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1028310386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -