BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0537 (616 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 27 0.36 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 5.9 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 23 5.9 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 27.5 bits (58), Expect = 0.36 Identities = 18/46 (39%), Positives = 22/46 (47%) Frame = +3 Query: 12 QEFGTRVAMASTVLTATTYVLNTLQMLLSLASPVPRYGSSSR*SAS 149 + F R+A A ATTY L T+ A PR SSS SA+ Sbjct: 413 RRFTIRMARAGPRSEATTYELVTIDGCFRRADSAPRGSSSSSSSAT 458 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.4 bits (48), Expect = 5.9 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +2 Query: 2 SPAAGIRHEGRHGLHRPHRDHVRSKHAADAPEPR 103 SPA G RH RHG + R + K EP+ Sbjct: 33 SPAPGSRHSIRHGRNGDKRSRM-IKELYQQTEPK 65 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 23.4 bits (48), Expect = 5.9 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 322 LEYNVRHQQSFAALASAGEPAA 257 LEY+V H+Q AL A + AA Sbjct: 263 LEYSVAHKQLVQALRKAPQQAA 284 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 552,342 Number of Sequences: 2352 Number of extensions: 11477 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -