BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0535 (576 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41868| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_59330| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_41868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 8.3 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +3 Query: 252 GSSLI*GVKRTVPIDAWLRRSSVLNGVSSIPGHLEELLTP-SLWHARLCCL 401 G + I G K VP++AWL ++S G S L+ L T S+ HA C+ Sbjct: 16 GRADIEGSKSNVPMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCI 66 >SB_59330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.5 bits (58), Expect = 8.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 340 IEDTPFKTELLLSHASIGTVLFT 272 ++D PF+ E L+ H IGT+L T Sbjct: 116 VDDDPFEGEDLVQHEQIGTMLAT 138 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,726,187 Number of Sequences: 59808 Number of extensions: 331455 Number of successful extensions: 806 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -