BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0533 (431 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1127 - 27807784-27807963,27808362-27808460,27809076-278091... 32 0.23 01_01_1018 - 8046819-8046876,8046995-8047212,8048099-8048177,804... 29 1.6 >06_03_1127 - 27807784-27807963,27808362-27808460,27809076-27809165, 27809272-27809404,27809539-27809624,27810028-27810099, 27810329-27810415,27810485-27810616,27810718-27810789, 27810957-27811037,27811871-27811963,27812298-27812465 Length = 430 Score = 31.9 bits (69), Expect = 0.23 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -1 Query: 374 TQYIEEEFVSQQADTIRSLAGHTSDLKRFITENNGKDLSLAVYLFDEYL 228 T Y +S + LAGHT+D+ E G++L LA L D+ L Sbjct: 272 TYYKTASLISNSCKAVAILAGHTADVSMLAYE-YGRNLGLAFQLIDDVL 319 >01_01_1018 - 8046819-8046876,8046995-8047212,8048099-8048177, 8048455-8048540,8048698-8048983,8049063-8049205, 8049308-8049508,8049626-8049754,8050463-8050738, 8050823-8051098,8051364-8052364,8052452-8052634, 8052865-8052937,8053205-8053313,8053622-8053785 Length = 1093 Score = 29.1 bits (62), Expect = 1.6 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -1 Query: 410 TKNSDLLHDAEITQYIEEEFVSQQADTIRSLAGHTSDLKRFITENN 273 T N DL H A+I YI E + ++ GHTSD + F E + Sbjct: 269 TGNRDLYH-AQIHPYINGEHKRDRCIQMKEKLGHTSDHEGFSREKS 313 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,085,697 Number of Sequences: 37544 Number of extensions: 171499 Number of successful extensions: 286 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 285 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 286 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 814473264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -