BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0533 (431 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 2.7 DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reduct... 23 6.1 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 2.7 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = -1 Query: 263 LSLAVYLFDEYLQKVV*TKF*NPIQFYHLVVFFFKQATLNF*VQIWLFNC 114 LSL + L YLQ QF H ++ A LN +W NC Sbjct: 213 LSLVIILSQYYLQP--------DFQFCHTFAYYHIIAMLNGFCSLWFVNC 254 >DQ013245-1|AAY34441.1| 487|Anopheles gambiae adrenodoxin reductase protein. Length = 487 Score = 22.6 bits (46), Expect = 6.1 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -1 Query: 425 IHREVTKNSDLLHDAEITQYIEEEFVSQQADTIRSLAGHTSDLKRFIT 282 + R V + D L +IT+Y E+ + DT+ L G L+ T Sbjct: 184 VARIVLSSVDDLKKTDITEYALEKLSRSRIDTVH-LVGRRGPLQAAFT 230 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 415,132 Number of Sequences: 2352 Number of extensions: 7831 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -