BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0531 (629 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0762 + 36078414-36078539,36078700-36078750,36078832-360789... 28 5.3 07_01_0420 + 3212498-3213076 27 9.3 02_01_0570 - 4195409-4195443,4196245-4196333,4196539-4196630,419... 27 9.3 >03_06_0762 + 36078414-36078539,36078700-36078750,36078832-36078981, 36079055-36079803,36079914-36080013,36080116-36080259, 36080333-36080452,36080532-36080846 Length = 584 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -3 Query: 504 SFSYRKKKKLERFENALSERVLRCV 430 S S KKKK+ + N LSER+++C+ Sbjct: 216 SSSSNKKKKMVQQPNKLSERIVKCL 240 >07_01_0420 + 3212498-3213076 Length = 192 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +2 Query: 68 NWTGSVACKAVLCALSASFLTFSIA*KLTQICMKL 172 +W+G+ A LCA++A FL + +TQ+C ++ Sbjct: 50 SWSGAAAVIVCLCAVAAVFLIMA---GITQLCKRV 81 >02_01_0570 - 4195409-4195443,4196245-4196333,4196539-4196630, 4196726-4196833,4196984-4197118,4197211-4197256, 4197358-4197458,4198285-4198422,4198503-4198601, 4198740-4198856,4199195-4199356,4199734-4199793, 4200371-4200538,4200608-4200718,4201401-4201499, 4201579-4201644,4202407-4202490,4202563-4202605, 4202684-4202739,4202817-4202925,4203442-4203524, 4203842-4203925,4204311-4204382,4204462-4204539, 4204633-4204716,4204806-4204876,4205943-4206012, 4206495-4206626,4207168-4207284,4208185-4208367 Length = 963 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 489 KKKKLERFENALSERVLRCVAFT-RKLQINY 400 K + +++ ++E LRCVAF R L +NY Sbjct: 514 KANQFKKYIEEMAEESLRCVAFAYRNLDLNY 544 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,212,770 Number of Sequences: 37544 Number of extensions: 240777 Number of successful extensions: 441 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 441 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1537558360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -