BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0531 (629 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43462| Best HMM Match : VWA (HMM E-Value=5.8e-22) 29 2.4 SB_4444| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_43462| Best HMM Match : VWA (HMM E-Value=5.8e-22) Length = 320 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 107 HRALPYRPRYQSSSGARRDAHVIFYFIIFLVPNS 6 HR L P + +S +RD FY +IF V +S Sbjct: 115 HRILRRAPEFPGASRTKRDVKASFYDVIFAVDSS 148 >SB_4444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 27.9 bits (59), Expect = 7.2 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +3 Query: 399 GS*FAIFL*TLHILVLSLTAHFRIVLIFFFFGN*KTCNFNYKHIVFLVFLFIL 557 G+ F L L + +S+ FR+ I F+G K C F+ +V ++ IL Sbjct: 60 GNFFVASLALLDGVPMSIVIAFRLAFIHDFYGAVKVCAFSATLLVTTIYCIIL 112 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 27.5 bits (58), Expect = 9.5 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = -2 Query: 484 KKIRTIRKCAVRESTKMCSVHKKIAN*LPSHTRCRRWTRVSQCELSYICLC 332 +++R + +C + ES V L CRR V +CELS C Sbjct: 570 RRVRVVGECELSESASCWRVRVVGECELSESASCRRVRVVRECELSESASC 620 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,447,568 Number of Sequences: 59808 Number of extensions: 311594 Number of successful extensions: 632 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -