Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0531
         (629 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g51420.1 68418.m06375 long-chain-alcohol O-fatty-acyltransfer...    27   7.8  

>At5g51420.1 68418.m06375 long-chain-alcohol O-fatty-acyltransferase
           family protein / wax synthase family protein contains
           similarity to wax synthase  wax synthase - Simmondsia
           chinensis, PID:g5020219  similar to wax synthase
           [gi:5020219] from Simmondsia chinensis
          Length = 435

 Score = 27.5 bits (58), Expect = 7.8
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 4/35 (11%)
 Frame = +2

Query: 164 MKLEQRPKRREHF----YGVETVFTRPRTLKILHL 256
           +KL+Q PKRR++F    Y +E +F+     K++ L
Sbjct: 102 IKLQQNPKRRDYFFQWEYPIEVLFSNQFVTKVVIL 136


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,856,102
Number of Sequences: 28952
Number of extensions: 207761
Number of successful extensions: 371
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 363
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 371
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1285411824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)