BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0530 (429 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0869 + 20421368-20421548,20421781-20422664,20422747-204229... 27 4.9 10_08_0114 - 14911119-14911301,14911458-14911550,14911634-149116... 27 6.4 >04_03_0869 + 20421368-20421548,20421781-20422664,20422747-20422905, 20423008-20423252,20423360-20423453,20423580-20423768 Length = 583 Score = 27.5 bits (58), Expect = 4.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 313 QLNYGYDYQPPRHYTERRDYYQNQQDLIPQ 402 +L GY +QPP+H+ YY+ L Q Sbjct: 45 KLRTGYHFQPPKHWINGPMYYKGLYHLFYQ 74 >10_08_0114 - 14911119-14911301,14911458-14911550,14911634-14911678, 14911831-14911953,14912090-14912177,14912976-14913118 Length = 224 Score = 27.1 bits (57), Expect = 6.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 299 VGGDGN*ITDMIINPPDIIPKEETIIKT 382 VGGDG D++ +P I+P + I+ T Sbjct: 26 VGGDGAEPVDLVEHPSGIVPTLQNIVST 53 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,490,985 Number of Sequences: 37544 Number of extensions: 171502 Number of successful extensions: 302 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 302 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 802495716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -