BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0530 (429 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U13642-4|AAG00043.2| 687|Caenorhabditis elegans Hypothetical pr... 28 2.5 Z47811-3|CAA87787.2| 723|Caenorhabditis elegans Hypothetical pr... 27 4.3 AF489839-1|AAN09795.1| 723|Caenorhabditis elegans lim and trans... 27 4.3 U80450-2|AAK77614.1| 252|Caenorhabditis elegans Hypothetical pr... 27 5.7 U80450-1|AAK77613.1| 244|Caenorhabditis elegans Hypothetical pr... 27 5.7 Z71180-3|CAA94892.2| 763|Caenorhabditis elegans Hypothetical pr... 27 7.5 AL021474-7|CAA16311.2| 763|Caenorhabditis elegans Hypothetical ... 27 7.5 AF016451-9|AAB66005.2| 524|Caenorhabditis elegans Udp-glucurono... 27 7.5 >U13642-4|AAG00043.2| 687|Caenorhabditis elegans Hypothetical protein ZC395.8 protein. Length = 687 Score = 28.3 bits (60), Expect = 2.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 289 NRHRRRRWQLNYGYDYQPPRHYTERRDYYQNQQ 387 NR+ RW N DY PR+Y+ R + +NQ+ Sbjct: 600 NRNYDERWSRN---DYSNPRNYSNRSFHQRNQR 629 >Z47811-3|CAA87787.2| 723|Caenorhabditis elegans Hypothetical protein K02C4.4 protein. Length = 723 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 385 VGFDNSLFFRYNVGGVDNHIRNLVAISSYG 296 + F SLFF+YN+ +DN + + V G Sbjct: 472 IPFVRSLFFKYNLSFIDNKLESTVYTDKSG 501 >AF489839-1|AAN09795.1| 723|Caenorhabditis elegans lim and transglutaminase domainprotein protein. Length = 723 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 385 VGFDNSLFFRYNVGGVDNHIRNLVAISSYG 296 + F SLFF+YN+ +DN + + V G Sbjct: 472 IPFVRSLFFKYNLSFIDNKLESTVYTDKSG 501 >U80450-2|AAK77614.1| 252|Caenorhabditis elegans Hypothetical protein M01E11.4b protein. Length = 252 Score = 27.1 bits (57), Expect = 5.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 324 RI*LSTPPTLYRKKRLLSKPTGSDPSDI 407 R+ + TP T +RK LL K + PSD+ Sbjct: 214 RVEVDTPETFHRKVWLLRKKSTQPPSDV 241 >U80450-1|AAK77613.1| 244|Caenorhabditis elegans Hypothetical protein M01E11.4a protein. Length = 244 Score = 27.1 bits (57), Expect = 5.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 324 RI*LSTPPTLYRKKRLLSKPTGSDPSDI 407 R+ + TP T +RK LL K + PSD+ Sbjct: 206 RVEVDTPETFHRKVWLLRKKSTQPPSDV 233 >Z71180-3|CAA94892.2| 763|Caenorhabditis elegans Hypothetical protein F22E12.1 protein. Length = 763 Score = 26.6 bits (56), Expect = 7.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 195 VNNRYKQQEPKN*GEFIHLGTRAISDKNN 109 + R+K Q+ K IHLGTR S N+ Sbjct: 286 MKRRFKMQKKKLPPRMIHLGTRPASQSNS 314 >AL021474-7|CAA16311.2| 763|Caenorhabditis elegans Hypothetical protein F22E12.1 protein. Length = 763 Score = 26.6 bits (56), Expect = 7.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 195 VNNRYKQQEPKN*GEFIHLGTRAISDKNN 109 + R+K Q+ K IHLGTR S N+ Sbjct: 286 MKRRFKMQKKKLPPRMIHLGTRPASQSNS 314 >AF016451-9|AAB66005.2| 524|Caenorhabditis elegans Udp-glucuronosyltransferase protein51 protein. Length = 524 Score = 26.6 bits (56), Expect = 7.5 Identities = 13/45 (28%), Positives = 27/45 (60%) Frame = -3 Query: 340 VDNHIRNLVAISSYGVCLGSGNLFLS*SRFVRHHLQNFQSLFCRH 206 VD+H+ NL++ SS G + S + + + R+ ++NF +F ++ Sbjct: 277 VDHHLDNLLSKSSNGTIIFSFGTQIPGAVYPRYAVRNFVKVFKKY 321 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,176,114 Number of Sequences: 27780 Number of extensions: 148163 Number of successful extensions: 297 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 297 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 713998766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -