BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0530 (429 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g09700.1 68417.m01594 hypothetical protein similar to zinc fi... 31 0.25 At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative simila... 29 1.0 At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative simila... 29 1.0 At1g47790.1 68414.m05317 F-box family protein contains Pfam:PF00... 28 3.1 At5g58890.1 68418.m07378 MADS-box family protein various predict... 26 9.4 At1g25570.1 68414.m03174 leucine-rich repeat protein-related co... 26 9.4 >At4g09700.1 68417.m01594 hypothetical protein similar to zinc finger protein [Arabidopsis thaliana] GI:976277 Length = 371 Score = 31.5 bits (68), Expect = 0.25 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 6/56 (10%) Frame = +1 Query: 250 QSDFKKERDYPTLNRHRRRRWQLNYG------YDYQPPRHYTERRDYYQNQQDLIP 399 +SD +++ DYP+ HR R + ++ DY P Y RRD ++ DL P Sbjct: 278 RSDHREKSDYPSAYSHRHREPRRDFSPQDCSRRDYSRPASYNFRRDSVRSGFDLHP 333 >At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative similar to ATP-dependent RNA helicases Length = 505 Score = 29.5 bits (63), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 310 WQLNYGYDYQPPRHYTERRDYYQNQQDLIPQ 402 +Q GY PP Y +R +Y QN Q Q Sbjct: 24 YQSRSGYQQHPPPQYVQRGNYAQNHQQQFQQ 54 >At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative similar to ATP-dependent RNA helicases Length = 505 Score = 29.5 bits (63), Expect = 1.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 310 WQLNYGYDYQPPRHYTERRDYYQNQQDLIPQ 402 +Q GY PP Y +R +Y QN Q Q Sbjct: 24 YQSRSGYQQHPPPQYVQRGNYAQNHQQQFQQ 54 >At1g47790.1 68414.m05317 F-box family protein contains Pfam:PF00646 F-box domain Length = 389 Score = 27.9 bits (59), Expect = 3.1 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +3 Query: 351 LYRKKRLLSKPTGSDPSDI 407 +YR++RL SKPT S P D+ Sbjct: 11 VYRRRRLQSKPTSSFPLDL 29 >At5g58890.1 68418.m07378 MADS-box family protein various predicted proteins, Oryza sativa and Arabidopsis thaliana Length = 294 Score = 26.2 bits (55), Expect = 9.4 Identities = 9/19 (47%), Positives = 16/19 (84%) Frame = +2 Query: 323 TDMIINPPDIIPKEETIIK 379 TD++I+ P+I PK+ET ++ Sbjct: 54 TDVVISEPEIWPKDETKVR 72 >At1g25570.1 68414.m03174 leucine-rich repeat protein-related contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains some similarity to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376 Length = 628 Score = 26.2 bits (55), Expect = 9.4 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +1 Query: 310 WQLNYGYDYQPPRHYTE---RRDYYQNQQDLI 396 W+ + YD+ PP T +R+ YQ Q+ L+ Sbjct: 577 WRGRHDYDFAPPHDLTSLAAKRNRYQRQKSLM 608 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,698,229 Number of Sequences: 28952 Number of extensions: 137011 Number of successful extensions: 256 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 255 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 675111616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -