BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0527 (453 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6PF65 Cluster: Putative uncharacterized protein precur... 33 2.9 UniRef50_O96204 Cluster: Putative uncharacterized protein PFB055... 32 6.6 >UniRef50_A6PF65 Cluster: Putative uncharacterized protein precursor; n=1; Shewanella sediminis HAW-EB3|Rep: Putative uncharacterized protein precursor - Shewanella sediminis HAW-EB3 Length = 242 Score = 33.1 bits (72), Expect = 2.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 25 IIYLDTKPYLFYPSFNPITGIYAIVKQLC 111 ++YL K LFY S+N +TGI + LC Sbjct: 138 LVYLSMKGRLFYSSWNAVTGILTFISFLC 166 >UniRef50_O96204 Cluster: Putative uncharacterized protein PFB0555c; n=4; Plasmodium|Rep: Putative uncharacterized protein PFB0555c - Plasmodium falciparum (isolate 3D7) Length = 4091 Score = 31.9 bits (69), Expect = 6.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 208 YSHFAVMYFNIIHNRPMFLQLFF*IIVIHSHGYK 107 Y ++ Y N ++N P+FL LF + IH H +K Sbjct: 3066 YLKKSIKYNNHLYNMPIFLSLFLRCVTIHLHYFK 3099 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 408,547,416 Number of Sequences: 1657284 Number of extensions: 7367506 Number of successful extensions: 13873 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13872 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 23511729640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -