BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0527 (453 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homoc... 23 6.7 >AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homocysteine hydrolase protein. Length = 432 Score = 22.6 bits (46), Expect = 6.7 Identities = 11/50 (22%), Positives = 24/50 (48%) Frame = +1 Query: 202 GCIDIVIAKTF*YLAGENILCDSKAESKCSNESRFFKILIIYRENASPQL 351 GC DI++ + F + ++I+C+ C + + + + N PQ+ Sbjct: 277 GCTDIIMGEHFLNMKDDSIVCNI-GHFDCEINVTWLQENAVEKVNIKPQV 325 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 457,810 Number of Sequences: 2352 Number of extensions: 9254 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38694201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -