BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0527 (453 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF098993-7|ABN43095.1| 525|Caenorhabditis elegans Hypothetical ... 29 1.6 AF098993-6|AAC67469.2| 562|Caenorhabditis elegans Hypothetical ... 29 1.6 AF002197-1|AAB53982.1| 383|Caenorhabditis elegans Hypothetical ... 28 3.7 AB275893-1|BAF34316.1| 383|Caenorhabditis elegans hypothetical ... 28 3.7 AL132952-11|CAB61148.1| 136|Caenorhabditis elegans Hypothetical... 27 6.4 AF003136-1|AAK21379.3| 896|Caenorhabditis elegans Importin beta... 27 6.4 U41272-2|AAA82447.1| 143|Caenorhabditis elegans Hypothetical pr... 27 8.4 >AF098993-7|ABN43095.1| 525|Caenorhabditis elegans Hypothetical protein T10B11.7b protein. Length = 525 Score = 29.1 bits (62), Expect = 1.6 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Frame = +2 Query: 314 SLSFIEKTLHHNYLVRISRSYIHVP*HFCF------SEINMSIHYF 433 SL I++ HH + V S SY V HFC E+N S++ F Sbjct: 125 SLLPIQRPSHHTFCVFCSESYPPVEFHFCIFMTAAQKEVNQSVNEF 170 >AF098993-6|AAC67469.2| 562|Caenorhabditis elegans Hypothetical protein T10B11.7a protein. Length = 562 Score = 29.1 bits (62), Expect = 1.6 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Frame = +2 Query: 314 SLSFIEKTLHHNYLVRISRSYIHVP*HFCF------SEINMSIHYF 433 SL I++ HH + V S SY V HFC E+N S++ F Sbjct: 162 SLLPIQRPSHHTFCVFCSESYPPVEFHFCIFMTAAQKEVNQSVNEF 207 >AF002197-1|AAB53982.1| 383|Caenorhabditis elegans Hypothetical protein F20H11.5 protein. Length = 383 Score = 27.9 bits (59), Expect = 3.7 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 241 LAGENILCDSKAESKCSNESRFFKILIIYRENASPQLFG 357 L +IL DSK + ES + ++ YR+ A P+LFG Sbjct: 105 LVSGHILSDSKTKLDSQRES-YGSLVYNYRDLAEPELFG 142 >AB275893-1|BAF34316.1| 383|Caenorhabditis elegans hypothetical protein protein. Length = 383 Score = 27.9 bits (59), Expect = 3.7 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 241 LAGENILCDSKAESKCSNESRFFKILIIYRENASPQLFG 357 L +IL DSK + ES + ++ YR+ A P+LFG Sbjct: 105 LVSGHILSDSKTKLDSQRES-YGSLVYNYRDLAEPELFG 142 >AL132952-11|CAB61148.1| 136|Caenorhabditis elegans Hypothetical protein Y51H4A.16 protein. Length = 136 Score = 27.1 bits (57), Expect = 6.4 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 174 IMLKYITAKWLYRHSYS*NVLVFSG 248 I+L YI + +Y+HS NVL+F G Sbjct: 109 ILLYYILIRVIYKHSNLENVLMFHG 133 >AF003136-1|AAK21379.3| 896|Caenorhabditis elegans Importin beta family protein 1 protein. Length = 896 Score = 27.1 bits (57), Expect = 6.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 368 VKYEPNNCGEAFSR*MIRILKKRDSLLHFDS 276 +K+ P +C A + ILKK +SLL +S Sbjct: 544 IKHSPKDCYSAVRNTTVVILKKLESLLQMES 574 >U41272-2|AAA82447.1| 143|Caenorhabditis elegans Hypothetical protein T03G11.5 protein. Length = 143 Score = 26.6 bits (56), Expect = 8.4 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +1 Query: 289 SNESRFFKILIIYRENASPQLFGSYFTFIYTCSLTLLF**NQYVYSLFHK 438 + S F I + S L SY +CSL + F ++Y LF++ Sbjct: 94 ATSSTFNNITLPENSKESQLLVNSYPHVFQSCSLIIFFVTKMFIYKLFYQ 143 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,911,981 Number of Sequences: 27780 Number of extensions: 193851 Number of successful extensions: 405 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 799252350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -