BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0523 (493 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0212 + 10260690-10261272,10261921-10262435,10262446-102625... 27 6.2 03_03_0246 + 15789635-15794227,15794314-15794555,15794630-157947... 27 6.2 >05_03_0212 + 10260690-10261272,10261921-10262435,10262446-10262569, 10262840-10263042,10263169-10263240,10264905-10265007, 10265350-10265582 Length = 610 Score = 27.5 bits (58), Expect = 6.2 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +2 Query: 299 QMNSWRSSPWTRTIW 343 Q +WR++P+TRT+W Sbjct: 231 QSPNWRAAPFTRTVW 245 >03_03_0246 + 15789635-15794227,15794314-15794555,15794630-15794771, 15796089-15796272,15796349-15796696,15796753-15797450, 15798208-15798900 Length = 2299 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +1 Query: 262 FEEGLMSDTWTAPNELMEIFSMDQDYLDFLEESIPDFNIC-SENVSETSKA 411 F+EG+ + PN +E+ SM + +E+ + ++C S+ V+E KA Sbjct: 1012 FDEGVQVEI--PPNPEVELVSMKNTHSGVMEQQVGSSSVCPSDLVTEAEKA 1060 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,553,891 Number of Sequences: 37544 Number of extensions: 210481 Number of successful extensions: 403 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 403 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1023611560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -