BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0521 (493 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 24 1.0 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 7.1 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 7.1 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 9.4 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 9.4 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 23.8 bits (49), Expect = 1.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 64 SNNQKTYCKMYLLSTEVFRQISSML 138 +NNQ T+CK +T+ IS L Sbjct: 3 TNNQDTFCKKMRKATKEIHSISDSL 27 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 37 LLTLDFYFTSNNQKTYCKMYLLSTEVFRQI 126 LLT S +TYC ++ LS + F + Sbjct: 525 LLTNARRVASVRAETYCNLFSLSVDHFNAV 554 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 37 LLTLDFYFTSNNQKTYCKMYLLSTEVFRQI 126 LLT S +TYC ++ LS + F + Sbjct: 493 LLTNARRVASVRAETYCNLFSLSVDHFNAV 522 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 20.6 bits (41), Expect = 9.4 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -1 Query: 226 FNSSFKDFNAICNVLSVKGFWLISNASVFEAWMKSGEIP 110 FN+ +D+ + VL W+ + AS+ ++ E P Sbjct: 471 FNAEDQDWGFVAMVLDRLFLWIFTIASIVGTFIILCEAP 509 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 484 SFANTASPLHCTS 446 S N SPL CTS Sbjct: 6 SMYNNVSPLQCTS 18 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,838 Number of Sequences: 438 Number of extensions: 2780 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13544190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -