BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0516 (480 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 4.5 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 5.9 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 5.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 5.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 5.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 5.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 5.9 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 102 YFCRSKFVNSFYFISY 55 Y + F+N+FYFI + Sbjct: 287 YIILTSFLNNFYFIIF 302 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.0 bits (42), Expect = 5.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 147 IKMNFVIPFVSLLLW 191 +KM VI FV +L W Sbjct: 285 VKMTLVIVFVFVLCW 299 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.0 bits (42), Expect = 5.9 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 477 PHHCIKVQH 451 PHH IK+QH Sbjct: 105 PHHEIKLQH 113 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.9 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -2 Query: 356 FLKVFL*TFYMLFQFLTCLTILLSE*DNKLFFFSYKFQKFIITYIEQTL 210 F+ +F+ + L F++ L ILL + FFF+ +F + T+ Q L Sbjct: 297 FIYMFVSVWKCLLFFVSVLFILLVKEGEVAFFFT-QFSEGFSTHQIQVL 344 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.9 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -2 Query: 356 FLKVFL*TFYMLFQFLTCLTILLSE*DNKLFFFSYKFQKFIITYIEQTL 210 F+ +F+ + L F++ L ILL + FFF+ +F + T+ Q L Sbjct: 297 FIYMFVSVWKCLLFFVSVLFILLVKEGEVAFFFT-QFSEGFSTHQIQVL 344 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.9 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -2 Query: 356 FLKVFL*TFYMLFQFLTCLTILLSE*DNKLFFFSYKFQKFIITYIEQTL 210 F+ +F+ + L F++ L ILL + FFF+ +F + T+ Q L Sbjct: 297 FIYMFVSVWKCLLFFVSVLFILLVKEGEVAFFFT-QFSEGFSTHQIQVL 344 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 5.9 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -2 Query: 356 FLKVFL*TFYMLFQFLTCLTILLSE*DNKLFFFSYKFQKFIITYIEQTL 210 F+ +F+ + L F++ L ILL + FFF+ +F + T+ Q L Sbjct: 297 FIYMFVSVWKCLLFFVSVLFILLVKEGEVAFFFT-QFSEGFSTHQIQVL 344 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,890 Number of Sequences: 336 Number of extensions: 1748 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -