BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0516 (480 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0998 - 21555696-21556080,21556177-21556254,21556333-215564... 27 6.0 >04_03_0998 - 21555696-21556080,21556177-21556254,21556333-21556424, 21556524-21556620,21557113-21557141,21557620-21557781, 21557981-21558061,21558156-21558314,21558394-21558510, 21558598-21558666,21558753-21558831,21560884-21561050, 21561109-21561229,21561522-21561649,21562293-21562361, 21562408-21562539,21562619-21562991,21563274-21563398, 21563500-21563655,21563785-21564198,21564634-21564691, 21566522-21566648,21568047-21568305,21569005-21569104, 21569231-21569317,21569454-21569692,21569914-21569999, 21570409-21570532,21571111-21574332 Length = 2444 Score = 27.5 bits (58), Expect = 6.0 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 276 VLFTKQNCETCKKLEQHVESLQEDFKKHL-NAMSVKTVNSHLAR 404 V+ TKQ T LE + S+ ++ KKH + +S+ HLA+ Sbjct: 2141 VMMTKQTYSTTHILEVYRGSVNQNVKKHRHDTLSLHGAGKHLAK 2184 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,891,791 Number of Sequences: 37544 Number of extensions: 125853 Number of successful extensions: 257 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 257 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 991020332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -