BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0516 (480 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 24 3.1 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 5.4 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 5.4 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 5.4 EF588665-1|ABQ96851.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588664-1|ABQ96850.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588663-1|ABQ96849.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588662-1|ABQ96848.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588661-1|ABQ96847.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588660-1|ABQ96846.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588659-1|ABQ96845.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588658-1|ABQ96844.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588656-1|ABQ96842.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588655-1|ABQ96841.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588653-1|ABQ96839.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588650-1|ABQ96837.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588649-1|ABQ96836.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588647-1|ABQ96835.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588646-1|ABQ96834.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588642-1|ABQ96832.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588641-1|ABQ96831.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588640-1|ABQ96830.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588639-1|ABQ96829.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588638-1|ABQ96828.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588637-1|ABQ96827.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588633-1|ABQ96823.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588631-1|ABQ96821.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588630-1|ABQ96820.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588629-1|ABQ96819.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588627-1|ABQ96817.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588626-1|ABQ96816.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588624-1|ABQ96814.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588623-1|ABQ96813.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588622-1|ABQ96812.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588621-1|ABQ96811.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588620-1|ABQ96810.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588617-1|ABQ96808.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588616-1|ABQ96807.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588614-1|ABQ96805.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588612-1|ABQ96803.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588611-1|ABQ96802.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588610-1|ABQ96801.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588609-1|ABQ96800.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588608-1|ABQ96799.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588607-1|ABQ96798.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588606-1|ABQ96797.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588605-1|ABQ96796.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588604-1|ABQ96795.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588603-1|ABQ96794.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588602-1|ABQ96793.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588601-1|ABQ96792.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588600-1|ABQ96791.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588599-1|ABQ96790.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588598-1|ABQ96789.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588597-1|ABQ96788.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588596-1|ABQ96787.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588595-1|ABQ96786.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588591-1|ABQ96785.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588590-1|ABQ96784.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588589-1|ABQ96783.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588588-1|ABQ96782.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588587-1|ABQ96781.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588586-1|ABQ96780.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588585-1|ABQ96779.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588584-1|ABQ96778.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588583-1|ABQ96777.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588582-1|ABQ96776.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588581-1|ABQ96775.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588580-1|ABQ96774.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588579-1|ABQ96773.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588577-1|ABQ96772.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588576-1|ABQ96771.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588574-1|ABQ96770.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588571-1|ABQ96769.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588570-1|ABQ96768.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588569-1|ABQ96767.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588568-1|ABQ96766.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588567-1|ABQ96765.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588566-1|ABQ96764.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588565-1|ABQ96763.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588564-1|ABQ96762.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588563-1|ABQ96761.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588562-1|ABQ96760.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588561-1|ABQ96759.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588560-1|ABQ96758.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588559-1|ABQ96757.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588558-1|ABQ96756.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588557-1|ABQ96755.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588556-1|ABQ96754.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588555-1|ABQ96753.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588554-1|ABQ96752.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588553-1|ABQ96751.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588551-1|ABQ63507.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588550-1|ABQ63506.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588549-1|ABQ63505.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588548-1|ABQ63504.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588547-1|ABQ63503.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588546-1|ABQ63502.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588545-1|ABQ63501.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588544-1|ABQ63500.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588543-1|ABQ63499.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588542-1|ABQ63498.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588541-1|ABQ63497.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588540-1|ABQ63496.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588539-1|ABQ63495.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588538-1|ABQ63494.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588537-1|ABQ63493.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588536-1|ABQ63492.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588535-1|ABQ63491.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588534-1|ABQ63490.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588533-1|ABQ63489.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588532-1|ABQ63488.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588531-1|ABQ63487.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588530-1|ABQ63486.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588529-1|ABQ63485.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588528-1|ABQ63484.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588527-1|ABQ63483.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588526-1|ABQ63482.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588525-1|ABQ63481.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588524-1|ABQ63480.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588523-1|ABQ63479.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588522-1|ABQ63478.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588521-1|ABQ63477.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588520-1|ABQ63476.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588519-1|ABQ63475.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588518-1|ABQ96750.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588517-1|ABQ96749.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588516-1|ABQ96748.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588515-1|ABQ96747.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588514-1|ABQ96746.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588512-1|ABQ96745.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588509-1|ABQ96744.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588508-1|ABQ96743.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588507-1|ABQ96742.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588506-1|ABQ96741.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588505-1|ABQ96740.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588504-1|ABQ96739.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588503-1|ABQ96738.1| 169|Anopheles gambiae transposase protein. 23 7.2 EF588502-1|ABQ96737.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588501-1|ABQ96736.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588500-1|ABQ96735.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588499-1|ABQ96734.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588498-1|ABQ96733.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588497-1|ABQ96732.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588496-1|ABQ96731.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588494-1|ABQ96730.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588493-1|ABQ96729.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588492-1|ABQ96728.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588491-1|ABQ96727.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588490-1|ABQ96726.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588489-1|ABQ96725.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588488-1|ABQ96724.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588487-1|ABQ96723.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588486-1|ABQ96722.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588485-1|ABQ96721.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588484-1|ABQ96720.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588483-1|ABQ96719.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588482-1|ABQ96718.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588481-1|ABQ96717.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588480-1|ABQ96716.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588479-1|ABQ96715.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588478-1|ABQ96714.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588477-1|ABQ96713.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588476-1|ABQ96712.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588475-1|ABQ96711.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588474-1|ABQ96710.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588473-1|ABQ96709.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588472-1|ABQ96708.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588471-1|ABQ96707.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588470-1|ABQ96706.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588468-1|ABQ96704.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588467-1|ABQ96703.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588466-1|ABQ96702.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588465-1|ABQ96701.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588464-1|ABQ96700.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588463-1|ABQ96699.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588462-1|ABQ96698.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588461-1|ABQ96697.1| 176|Anopheles gambiae transposase protein. 23 7.2 EF588460-1|ABQ96696.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588459-1|ABQ96695.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588458-1|ABQ96694.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588457-1|ABQ96693.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588456-1|ABQ96692.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588455-1|ABQ96691.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588454-1|ABQ96690.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588453-1|ABQ96689.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588452-1|ABQ96688.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588451-1|ABQ96687.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588450-1|ABQ96686.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588449-1|ABQ96685.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588448-1|ABQ96684.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588447-1|ABQ96683.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588446-1|ABQ96682.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588445-1|ABQ96681.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588444-1|ABQ96680.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588443-1|ABQ96679.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588442-1|ABQ96678.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588441-1|ABQ96677.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588440-1|ABQ96676.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588439-1|ABQ96675.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588438-1|ABQ96674.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588437-1|ABQ96673.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588436-1|ABQ96672.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588435-1|ABQ96671.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588434-1|ABQ96670.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588433-1|ABQ96669.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588432-1|ABQ96668.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588431-1|ABQ96667.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588430-1|ABQ96666.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588429-1|ABQ96665.1| 177|Anopheles gambiae transposase protein. 23 7.2 EF588428-1|ABQ96664.1| 177|Anopheles gambiae transposase protein. 23 7.2 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 23 7.2 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 23 7.2 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 22 9.5 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.8 bits (49), Expect = 3.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 288 KQNCETCKKLEQHVESLQE 344 + NC T + LEQ + LQE Sbjct: 268 ESNCATAQTLEQEAKELQE 286 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 5.4 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 28 VLSDKWFFYITNEVKRVNKLTSTKILIKILKHINC 132 +LS + + + NE+ R+NKL S + L + NC Sbjct: 1484 LLSHRLYDVLGNEIGRINKLGSIENLSFQSRISNC 1518 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 5.4 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 28 VLSDKWFFYITNEVKRVNKLTSTKILIKILKHINC 132 +LS + + + NE+ R+NKL S + L + NC Sbjct: 1485 LLSHRLYDVLGNEIGRINKLGSIENLSFQSRISNC 1519 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = -2 Query: 305 CLTILLSE*DNKLFFFSYKFQKFIITYIEQTLRSY 201 C+ +L++ DNKL + + +++ + +TLR Y Sbjct: 333 CVRDVLAKHDNKLSYDAVMEMEYLGWIVNETLRLY 367 >EF588665-1|ABQ96851.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588664-1|ABQ96850.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588663-1|ABQ96849.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588662-1|ABQ96848.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588661-1|ABQ96847.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588660-1|ABQ96846.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588659-1|ABQ96845.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588658-1|ABQ96844.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588656-1|ABQ96842.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588655-1|ABQ96841.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588653-1|ABQ96839.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588650-1|ABQ96837.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588649-1|ABQ96836.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588647-1|ABQ96835.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588646-1|ABQ96834.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588642-1|ABQ96832.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588641-1|ABQ96831.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588640-1|ABQ96830.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588639-1|ABQ96829.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588638-1|ABQ96828.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588637-1|ABQ96827.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588633-1|ABQ96823.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588631-1|ABQ96821.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588630-1|ABQ96820.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588629-1|ABQ96819.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588627-1|ABQ96817.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588626-1|ABQ96816.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588624-1|ABQ96814.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588623-1|ABQ96813.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588622-1|ABQ96812.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588621-1|ABQ96811.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588620-1|ABQ96810.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588617-1|ABQ96808.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588616-1|ABQ96807.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588614-1|ABQ96805.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588612-1|ABQ96803.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588611-1|ABQ96802.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588610-1|ABQ96801.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588609-1|ABQ96800.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588608-1|ABQ96799.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588607-1|ABQ96798.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588606-1|ABQ96797.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588605-1|ABQ96796.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588604-1|ABQ96795.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588603-1|ABQ96794.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588602-1|ABQ96793.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588601-1|ABQ96792.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588600-1|ABQ96791.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588599-1|ABQ96790.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588598-1|ABQ96789.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588597-1|ABQ96788.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588596-1|ABQ96787.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588595-1|ABQ96786.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588591-1|ABQ96785.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588590-1|ABQ96784.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588589-1|ABQ96783.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588588-1|ABQ96782.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588587-1|ABQ96781.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588586-1|ABQ96780.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588585-1|ABQ96779.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588584-1|ABQ96778.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588583-1|ABQ96777.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588582-1|ABQ96776.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588581-1|ABQ96775.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588580-1|ABQ96774.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588579-1|ABQ96773.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588577-1|ABQ96772.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588576-1|ABQ96771.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588574-1|ABQ96770.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588571-1|ABQ96769.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588570-1|ABQ96768.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588569-1|ABQ96767.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588568-1|ABQ96766.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588567-1|ABQ96765.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588566-1|ABQ96764.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588565-1|ABQ96763.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588564-1|ABQ96762.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588563-1|ABQ96761.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588562-1|ABQ96760.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588561-1|ABQ96759.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588560-1|ABQ96758.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588559-1|ABQ96757.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588558-1|ABQ96756.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588557-1|ABQ96755.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588556-1|ABQ96754.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588555-1|ABQ96753.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588554-1|ABQ96752.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588553-1|ABQ96751.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588551-1|ABQ63507.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588550-1|ABQ63506.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588549-1|ABQ63505.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588548-1|ABQ63504.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588547-1|ABQ63503.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588546-1|ABQ63502.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588545-1|ABQ63501.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588544-1|ABQ63500.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588543-1|ABQ63499.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588542-1|ABQ63498.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588541-1|ABQ63497.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588540-1|ABQ63496.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588539-1|ABQ63495.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588538-1|ABQ63494.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588537-1|ABQ63493.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588536-1|ABQ63492.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588535-1|ABQ63491.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588534-1|ABQ63490.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588533-1|ABQ63489.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588532-1|ABQ63488.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588531-1|ABQ63487.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588530-1|ABQ63486.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588529-1|ABQ63485.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588528-1|ABQ63484.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588527-1|ABQ63483.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588526-1|ABQ63482.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588525-1|ABQ63481.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588524-1|ABQ63480.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588523-1|ABQ63479.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588522-1|ABQ63478.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588521-1|ABQ63477.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588520-1|ABQ63476.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588519-1|ABQ63475.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588518-1|ABQ96750.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588517-1|ABQ96749.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588516-1|ABQ96748.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588515-1|ABQ96747.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588514-1|ABQ96746.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588512-1|ABQ96745.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588509-1|ABQ96744.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588508-1|ABQ96743.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588507-1|ABQ96742.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588506-1|ABQ96741.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588505-1|ABQ96740.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588504-1|ABQ96739.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588503-1|ABQ96738.1| 169|Anopheles gambiae transposase protein. Length = 169 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588502-1|ABQ96737.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588501-1|ABQ96736.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588500-1|ABQ96735.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588499-1|ABQ96734.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588498-1|ABQ96733.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588497-1|ABQ96732.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588496-1|ABQ96731.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588494-1|ABQ96730.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588493-1|ABQ96729.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588492-1|ABQ96728.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588491-1|ABQ96727.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588490-1|ABQ96726.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588489-1|ABQ96725.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588488-1|ABQ96724.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588487-1|ABQ96723.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588486-1|ABQ96722.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588485-1|ABQ96721.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588484-1|ABQ96720.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588483-1|ABQ96719.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588482-1|ABQ96718.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588481-1|ABQ96717.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588480-1|ABQ96716.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588479-1|ABQ96715.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588478-1|ABQ96714.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588477-1|ABQ96713.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588476-1|ABQ96712.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588475-1|ABQ96711.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588474-1|ABQ96710.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588473-1|ABQ96709.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588472-1|ABQ96708.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588471-1|ABQ96707.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588470-1|ABQ96706.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588468-1|ABQ96704.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588467-1|ABQ96703.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588466-1|ABQ96702.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588465-1|ABQ96701.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588464-1|ABQ96700.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588463-1|ABQ96699.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588462-1|ABQ96698.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588461-1|ABQ96697.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 20 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 52 >EF588460-1|ABQ96696.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588459-1|ABQ96695.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588458-1|ABQ96694.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588457-1|ABQ96693.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588456-1|ABQ96692.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588455-1|ABQ96691.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCFYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588454-1|ABQ96690.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588453-1|ABQ96689.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588452-1|ABQ96688.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588451-1|ABQ96687.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588450-1|ABQ96686.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588449-1|ABQ96685.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588448-1|ABQ96684.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588447-1|ABQ96683.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588446-1|ABQ96682.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588445-1|ABQ96681.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588444-1|ABQ96680.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588443-1|ABQ96679.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588442-1|ABQ96678.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588441-1|ABQ96677.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588440-1|ABQ96676.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588439-1|ABQ96675.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588438-1|ABQ96674.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588437-1|ABQ96673.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588436-1|ABQ96672.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588435-1|ABQ96671.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588434-1|ABQ96670.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588433-1|ABQ96669.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588432-1|ABQ96668.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588431-1|ABQ96667.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588430-1|ABQ96666.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588429-1|ABQ96665.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >EF588428-1|ABQ96664.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 22.6 bits (46), Expect = 7.2 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 3/24 (12%) Frame = -1 Query: 129 IYVL*YFYKYFCRS---KFVNSFY 67 IY Y+Y Y+CR+ F+ FY Sbjct: 158 IYNNNYYYNYYCRNISHHFLRCFY 181 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 285 TKQNCETCKKLEQHVESLQEDFKKHLNAMSVKTV 386 T C C K+ ++ + + K+HLN + KTV Sbjct: 21 TGAKCLYCLKVFKYTKGTTSNLKRHLNLVH-KTV 53 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 22.2 bits (45), Expect = 9.5 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 90 FYKNTYKNIKAHKLLLPFEIKM 155 F K +KN ++ +L PF +K+ Sbjct: 41 FVKEIFKNHNSNVVLSPFSVKI 62 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 396,407 Number of Sequences: 2352 Number of extensions: 6694 Number of successful extensions: 225 Number of sequences better than 10.0: 214 Number of HSP's better than 10.0 without gapping: 224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 225 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 41863041 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -