BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0514 (596 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7NDF6 Cluster: Arginyl-tRNA synthetase; n=3; Cyanobact... 32 8.9 >UniRef50_Q7NDF6 Cluster: Arginyl-tRNA synthetase; n=3; Cyanobacteria|Rep: Arginyl-tRNA synthetase - Gloeobacter violaceus Length = 601 Score = 32.3 bits (70), Expect = 8.9 Identities = 25/65 (38%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = +2 Query: 80 LLLETPQCNSRRTSLLTH*CFYQFITLSFDSWQ-TIYLFHAKLSVS-FYEHEHVVDLLAE 253 L LETPQ + LL Y+F + + T Y + VS FYEH ++ LAE Sbjct: 506 LWLETPQERTLALRLLAAPDEYRFAAVDRTPQRLTQYAYDLASDVSQFYEHCPILPPLAE 565 Query: 254 DLEPA 268 +LEPA Sbjct: 566 NLEPA 570 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 467,217,052 Number of Sequences: 1657284 Number of extensions: 7521995 Number of successful extensions: 13300 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 13004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13299 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41902926763 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -