BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0514 (596 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 24 0.85 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 22 4.5 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 24.2 bits (50), Expect = 0.85 Identities = 9/36 (25%), Positives = 16/36 (44%) Frame = +3 Query: 135 NAFINLLRYLSILGKLFICFTPSYLCLFTSMNTSSI 242 N+ +L +L IC T Y C + N+ ++ Sbjct: 229 NSIYGFQNFLFVLSTFSICITQFYYCYDSGFNSDNL 264 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 14 RGVSVSLTNGHYGR 55 R V +SLT G+Y R Sbjct: 225 RAVEISLTTGNYSR 238 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,010 Number of Sequences: 336 Number of extensions: 1999 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -