BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0514 (596 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L14433-8|AAA27971.3| 1249|Caenorhabditis elegans Uncoordinated p... 30 1.1 >L14433-8|AAA27971.3| 1249|Caenorhabditis elegans Uncoordinated protein 36 protein. Length = 1249 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 152 ITLSFDSWQTIYLFHAKLSVSFYE--HEHVVDLLAEDLEPAPQTR 280 +T+ +++ IYL A L VS +E ++HVVD +AE PA R Sbjct: 924 LTMLGQAFKAIYLDKAVLGVSGFEFAYDHVVDTMAEHGCPASDDR 968 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,986,699 Number of Sequences: 27780 Number of extensions: 187260 Number of successful extensions: 352 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -