BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0503 (615 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1242 - 32016553-32016857,32017628-32017784,32017871-320180... 29 3.9 03_06_0116 + 31773295-31773603,31773800-31773946,31774080-317741... 29 3.9 12_02_0871 + 23865343-23866016,23866122-23866170,23866276-238663... 28 5.1 11_03_0142 + 10675764-10675991,10676533-10676943 27 8.9 01_05_0446 - 22334291-22334751,22335304-22336191,22336290-223365... 27 8.9 >04_04_1242 - 32016553-32016857,32017628-32017784,32017871-32018089, 32018184-32018470,32018629-32019934,32020021-32020178, 32020250-32020335,32023106-32023173,32023297-32023340, 32023418-32023490,32023605-32023684,32023774-32023867, 32023981-32024151,32024463-32024557,32025049-32025128, 32025137-32025333,32025896-32026183 Length = 1235 Score = 28.7 bits (61), Expect = 3.9 Identities = 23/86 (26%), Positives = 41/86 (47%) Frame = +3 Query: 210 SEEKSPKGIEDDLHKIVGVCDACFKEPSESDIEAILNSIVSIMVSIPLERGENLILAFSQ 389 +E+ +P G+E LH +C A SE + A L + VS+ L RG+ + +Q Sbjct: 283 TEQNNPVGLEVQLHITEALCPAL----SEPGLRAFLRFMTG--VSVCLNRGD--VDPKAQ 334 Query: 390 RLTKAPGPKLGMVALQSLWRLYNNLE 467 +L +A G L + + ++ + E Sbjct: 335 QLAEAAGSSLVSIIVDHIFLCIKDAE 360 >03_06_0116 + 31773295-31773603,31773800-31773946,31774080-31774158, 31777558-31778180 Length = 385 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 378 AFSQRLTKAPGPKLGMVALQSLWRLYNNLEPNSPLRYHVY 497 AFS+R K PK + L W L+ + P +R H+Y Sbjct: 227 AFSKRTKKGKLPKEARLKLLHWWELHYDKWPYPSVRTHIY 266 >12_02_0871 + 23865343-23866016,23866122-23866170,23866276-23866356, 23866599-23866718,23866957-23867055,23867135-23867194, 23867316-23867410,23867483-23867508,23869212-23869285, 23870194-23870259,23871027-23871099,23871585-23871622, 23873758-23873871,23876079-23876195,23876288-23876368, 23876468-23876536,23876631-23876669,23876809-23876973, 23877380-23877484,23877569-23877637,23877754-23877816, 23877903-23878021,23878124-23878348,23878409-23878610 Length = 940 Score = 28.3 bits (60), Expect = 5.1 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +3 Query: 72 CL*IINKRI-QFKKGI-KMQGPAVFMDISLXDQALELRRYFKSLGAEISEEKSPKGIED 242 C I++ RI + + GI K+QG + +D+SL L K G E EE K +ED Sbjct: 431 CGEIVDLRIMKDQNGISKLQGKRLAVDLSLDQDTLFFGNLCKDWGIEEFEELIRKALED 489 >11_03_0142 + 10675764-10675991,10676533-10676943 Length = 212 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 142 INTAGPCILIPFLNCILLFIIYKH*SECKN 53 + + GP + +P +NC LL ++ K C N Sbjct: 147 VGSLGPMVAVPCVNCHLLVMLCKSSPACPN 176 >01_05_0446 - 22334291-22334751,22335304-22336191,22336290-22336550, 22337129-22337588 Length = 689 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 504 VIELAARVGFVREVFTGVEQLRKEFANCPP 593 V+E + R+ +R + G+E L AN PP Sbjct: 521 VLEWSTRISIIRGIAKGIEYLHSTRANKPP 550 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,887,362 Number of Sequences: 37544 Number of extensions: 267597 Number of successful extensions: 678 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -