BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0503 (615 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59930.1 68418.m07515 DC1 domain-containing protein / UV-B li... 31 0.80 At1g76850.1 68414.m08943 expressed protein 29 2.4 At1g72910.1 68414.m08433 disease resistance protein (TIR-NBS cla... 28 4.3 At5g07280.1 68418.m00830 leucine-rich repeat protein kinase, put... 28 5.7 At4g33070.1 68417.m04711 pyruvate decarboxylase, putative strong... 28 5.7 At1g29150.1 68414.m03567 26S proteasome regulatory subunit, puta... 27 7.5 At3g45580.1 68416.m04923 zinc finger (C3HC4-type RING finger) fa... 27 9.9 >At5g59930.1 68418.m07515 DC1 domain-containing protein / UV-B light-insensitive protein, putative similar to ULI3 (UV-B light insensitive) [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 656 Score = 30.7 bits (66), Expect = 0.80 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = +1 Query: 121 CKGQLCLW--TYPXKIRHSN*EDIL 189 C LCLW + P KIRHSN E IL Sbjct: 519 CDFNLCLWCASLPKKIRHSNDEHIL 543 >At1g76850.1 68414.m08943 expressed protein Length = 1090 Score = 29.1 bits (62), Expect = 2.4 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +3 Query: 315 LNSIVSIMVSIPLERGENLILAFSQRLTKA-PGPKLGMVALQSLWRLYNNLEPNSPLRYH 491 L S V+I+ + LE E ++L F L K+ PK+ +L++ RL LEP S +H Sbjct: 380 LPSHVNILKRV-LEEVEKVMLEFKGTLYKSMEDPKIDFTSLENTVRLLLELEPESDPVWH 438 >At1g72910.1 68414.m08433 disease resistance protein (TIR-NBS class), putative domain signature TIR-NBS exists, suggestive of a disease resistance protein. Length = 380 Score = 28.3 bits (60), Expect = 4.3 Identities = 21/73 (28%), Positives = 34/73 (46%) Frame = -3 Query: 418 SLGPGALVSL*LNAKIRFSPLSNGIETIIETILFRMASMSDSLGSLKQASQTPTILCRSS 239 S GPG++V + + K + S GI + E + + SLG K+A+ LCR+ Sbjct: 299 SFGPGSVVIITTDNKGLLN--SYGITDVYEVEHLKFCGILRSLGFKKRAAAFQRALCRAK 356 Query: 238 SMPLGDFSSEISA 200 S F + S+ Sbjct: 357 SFATECFCCQSSS 369 >At5g07280.1 68418.m00830 leucine-rich repeat protein kinase, putative / extra sporogenous cells (ESP) identical to extra sporogenous cells [Arabidopsis thaliana] gi|23304947|emb|CAD42912; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1192 Score = 27.9 bits (59), Expect = 5.7 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 5/62 (8%) Frame = +3 Query: 345 IPLERGE-----NLILAFSQRLTKAPGPKLGMVALQSLWRLYNNLEPNSPLRYHVYYHVI 509 IP+E G+ L L + + P + LQ L YNNL + P + Y+H I Sbjct: 512 IPVELGDCTSLTTLDLGSNNLQGQIPDKITALAQLQCLVLSYNNLSGSIPSKPSAYFHQI 571 Query: 510 EL 515 E+ Sbjct: 572 EM 573 >At4g33070.1 68417.m04711 pyruvate decarboxylase, putative strong similarity to SP|P51846 Pyruvate decarboxylase isozyme 2 (EC 4.1.1.1) (PDC) {Nicotiana tabacum}; contains InterPro entry IPR000399: Pyruvate decarboxylase Length = 607 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/65 (24%), Positives = 29/65 (44%) Frame = +3 Query: 312 ILNSIVSIMVSIPLERGENLILAFSQRLTKAPGPKLGMVALQSLWRLYNNLEPNSPLRYH 491 I N S+ S+ L++ E I+ R+T A GP G + + +R + + Y Sbjct: 330 IFNDYSSVGYSLLLKK-EKAIVVQPDRITVANGPTFGCILMSDFFRELSKRVKRNETAYE 388 Query: 492 VYYHV 506 Y+ + Sbjct: 389 NYHRI 393 >At1g29150.1 68414.m03567 26S proteasome regulatory subunit, putative (RPN6) similar to 19S proteosome subunit 9 GB:AAC34120 GI:3450889 from [Arabidopsis thaliana] Length = 419 Score = 27.5 bits (58), Expect = 7.5 Identities = 14/63 (22%), Positives = 24/63 (38%) Frame = +3 Query: 222 SPKGIEDDLHKIVGVCDACFKEPSESDIEAILNSIVSIMVSIPLERGENLILAFSQRLTK 401 SP+ I I +CD +E D+ +L + IP + ++ + K Sbjct: 36 SPEAIRIKEQAITNLCDRLTEEKRGEDLRKLLTKLRPFFSLIPKAKTAKIVRGIIDAVAK 95 Query: 402 APG 410 PG Sbjct: 96 IPG 98 >At3g45580.1 68416.m04923 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature Length = 408 Score = 27.1 bits (57), Expect = 9.9 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = +2 Query: 428 SFAIVMETLQQLRTQLTSKIPCILS 502 +FA++M+ +Q +R +LTS P +++ Sbjct: 119 NFALLMDNVQHIRQRLTSSFPVLVT 143 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,341,075 Number of Sequences: 28952 Number of extensions: 228899 Number of successful extensions: 688 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 688 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -