BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0500 (541 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 23 1.5 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 23 1.5 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 23 1.5 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 23 2.6 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 6.1 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 8.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.1 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 23.4 bits (48), Expect = 1.5 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 105 VLSILDFLSALPVVSKSGACF 43 V +ILD S+ VVSKSG F Sbjct: 298 VQNILDTQSSAKVVSKSGVLF 318 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 23.4 bits (48), Expect = 1.5 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 105 VLSILDFLSALPVVSKSGACF 43 V +ILD S+ VVSKSG F Sbjct: 298 VQNILDTQSSAKVVSKSGVLF 318 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 23.4 bits (48), Expect = 1.5 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 105 VLSILDFLSALPVVSKSGACF 43 V +ILD S+ VVSKSG F Sbjct: 298 VQNILDTQSSAKVVSKSGVLF 318 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 22.6 bits (46), Expect = 2.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 184 EFGIRRHMHLDRLVRGIG 131 ++ + RH H+ RLV IG Sbjct: 104 KYWVERHKHIVRLVTAIG 121 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.4 bits (43), Expect = 6.1 Identities = 8/38 (21%), Positives = 17/38 (44%) Frame = +1 Query: 103 DYVEEVYDASQYHGQDGLGAYAYGYQTPESAKVENRVR 216 DY E +Y+G + + Y Y+ + + N ++ Sbjct: 247 DYGNEAISKREYNGIGAVIEFKYSYEISNAFRGNNNLK 284 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 8.1 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -1 Query: 163 MHLDRLVRGIGTHRILLQRSPQYSRFPFRSSSSV 62 MH D L T L + Q ++ P SSS+V Sbjct: 505 MHKDSLGLSTATSTCSLAVAKQQNQVPLTSSSNV 538 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 8.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 209 ASDPETSPARISTRTAKTISSRYVTGQTVTVSTRK 313 AS T PA S A + ++ +T T T+ TR+ Sbjct: 231 ASATGTGPATPSAVVATSNATAAMTTGTTTIPTRR 265 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.311 0.132 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,927 Number of Sequences: 438 Number of extensions: 2691 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.3 bits)
- SilkBase 1999-2023 -