BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0497 (620 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20G4.03c |hri1||eIF2 alpha kinase Hri1|Schizosaccharomyces p... 28 0.95 SPAC1A6.10 ||SPAC30D11.15c|Moeb/ThiF domain|Schizosaccharomyces ... 26 3.8 SPBC1105.14 |rsv2||transcription factor Rsv2|Schizosaccharomyces... 25 6.7 SPCC1494.09c |||sequence orphan|Schizosaccharomyces pombe|chr 3|... 25 6.7 SPAC4D7.03 |pop2|sud1|F-box/WD repeat protein Pop2|Schizosacchar... 25 8.8 SPCC736.06 |||aspartate-tRNA ligase|Schizosaccharomyces pombe|ch... 25 8.8 >SPAC20G4.03c |hri1||eIF2 alpha kinase Hri1|Schizosaccharomyces pombe|chr 1|||Manual Length = 704 Score = 28.3 bits (60), Expect = 0.95 Identities = 17/77 (22%), Positives = 35/77 (45%) Frame = +2 Query: 296 TPIQTPKDMVFSQTSLKTRNILKVVDLDRLKPEKNQQANGLTGVIHQGNNGVMPQGTVPT 475 TP Q+ + ++ SL+ I+ + L+P +N A+ L ++ + +P + Sbjct: 64 TPEQSKQMFLYVAHSLQNSGIIDFEFSEELEPIRNAYADSLHNLLSKAFRSTLPMSSTKD 123 Query: 476 ASFSEEYLKPEQLYAST 526 + S Y P+ + A T Sbjct: 124 SKKS-RYSSPDGVLAKT 139 >SPAC1A6.10 ||SPAC30D11.15c|Moeb/ThiF domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 485 Score = 26.2 bits (55), Expect = 3.8 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 3/88 (3%) Frame = -3 Query: 315 FGVWIGVLSSD-IVAPTRAGDLLSNH--FV*N*LNSS*APKEMLTL*APKQLTVPRVGLS 145 F WI V + + + P A DLLS + FV + +++ ++L+ +L V S Sbjct: 192 FAPWIEVDARNALFNPDSADDLLSGNPDFVIDAIDNIQTKVDLLSYCYNHKLPVIA---S 248 Query: 144 TMNVCKSFKTRVRCDSVFVKKESNLNRA 61 T + CKS TRV + E L+RA Sbjct: 249 TGSACKSDPTRVNIADISATSEDPLSRA 276 >SPBC1105.14 |rsv2||transcription factor Rsv2|Schizosaccharomyces pombe|chr 2|||Manual Length = 637 Score = 25.4 bits (53), Expect = 6.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 389 PEKNQQANGLTGVIHQGNNGVMPQGTVPTAS 481 P Q +TG G NG P T PT S Sbjct: 519 PNPTNQKVSITGAAADGPNGSAPVDTTPTNS 549 >SPCC1494.09c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 157 Score = 25.4 bits (53), Expect = 6.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 390 GFKRSRSTTFKMFRVLRLVCEKTMSFG 310 GF S TTFK+F +L +C + + G Sbjct: 83 GFPASPETTFKVFSLLDSLCLRLIQSG 109 >SPAC4D7.03 |pop2|sud1|F-box/WD repeat protein Pop2|Schizosaccharomyces pombe|chr 1|||Manual Length = 703 Score = 25.0 bits (52), Expect = 8.8 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +1 Query: 292 QYTNPNTKRHGFFANESQDSKHFESSRPRSFKARK 396 +Y NPN R F N+ +F R F RK Sbjct: 297 KYANPNLNRPPFLHNDQISDDYFPEIFKRHFLNRK 331 >SPCC736.06 |||aspartate-tRNA ligase|Schizosaccharomyces pombe|chr 3|||Manual Length = 611 Score = 25.0 bits (52), Expect = 8.8 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 Query: 73 VRFLFYKNGITSNSSFERLAYIHCTQAYSRD 165 VR + + GIT F+ + Y H Y D Sbjct: 275 VRLVSFAKGITLAKPFQHITYQHAIDKYGSD 305 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,503,494 Number of Sequences: 5004 Number of extensions: 50124 Number of successful extensions: 162 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 273658928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -