BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0495 (587 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 29 3.0 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 29 3.0 At2g14660.1 68415.m01649 expressed protein contains Pfam PF04543... 27 9.3 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -2 Query: 178 RLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAE 77 RLLPSL VV+ +P+ + P S LP + + V E Sbjct: 84 RLLPSLKVVSSLPSPARDPTPLSLLPFSKLKVLE 117 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -2 Query: 169 PSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 62 PS A + APSP +NP P T V++ ES Sbjct: 39 PSQSPRATAPAPSPSANPPPSAPTTAPPVSQPPTES 74 >At2g14660.1 68415.m01649 expressed protein contains Pfam PF04543: Family of unknown function (DUF589); similar to cThy28kD (GI:995778) [Gallus gallus]; similar to thymocyte protein mThy28 (GI:23978374) [Mus musculus] Length = 158 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 497 SRCSSVSVEVGRQFYSDCAFMVDNEAIYDI 586 SRC VEV R++Y+D A V+ E D+ Sbjct: 61 SRCVVGVVEVSREWYTDDAEGVEGEGAVDV 90 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,928,833 Number of Sequences: 28952 Number of extensions: 268614 Number of successful extensions: 649 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1161268208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -