BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0494 (543 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75536-4|CAA99832.3| 2271|Caenorhabditis elegans Hypothetical pr... 28 5.0 Z75536-3|CAA99831.3| 2279|Caenorhabditis elegans Hypothetical pr... 28 5.0 AF372457-1|AAK54248.1| 2279|Caenorhabditis elegans endocytosis p... 28 5.0 U55369-1|AAK52175.1| 1247|Caenorhabditis elegans Cystic fibrosis... 27 6.6 Z54238-7|CAJ90498.1| 1861|Caenorhabditis elegans Hypothetical pr... 27 8.7 >Z75536-4|CAA99832.3| 2271|Caenorhabditis elegans Hypothetical protein F18C12.2b protein. Length = 2271 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 196 ALELRRYFKSLGAEISEEKSPKGIEDDLHKI 288 A++L Y K AE++ PK I DDL +I Sbjct: 1726 AIDLLDYIKKHSAELTGAPKPKAISDDLIEI 1756 >Z75536-3|CAA99831.3| 2279|Caenorhabditis elegans Hypothetical protein F18C12.2a protein. Length = 2279 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 196 ALELRRYFKSLGAEISEEKSPKGIEDDLHKI 288 A++L Y K AE++ PK I DDL +I Sbjct: 1726 AIDLLDYIKKHSAELTGAPKPKAISDDLIEI 1756 >AF372457-1|AAK54248.1| 2279|Caenorhabditis elegans endocytosis protein RME-8 protein. Length = 2279 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 196 ALELRRYFKSLGAEISEEKSPKGIEDDLHKI 288 A++L Y K AE++ PK I DDL +I Sbjct: 1726 AIDLLDYIKKHSAELTGAPKPKAISDDLIEI 1756 >U55369-1|AAK52175.1| 1247|Caenorhabditis elegans Cystic fibrosis transmembrane conductanceregulator homolog protein 1 protein. Length = 1247 Score = 27.5 bits (58), Expect = 6.6 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 175 DISXEDQALELRRYFKSLGAEISEEKSPKGIEDDLHKIVGVCDACFK 315 DI +A +LR Y KSL + + SP+ + ++ V VC A K Sbjct: 1117 DIWLAIEACQLREYVKSLPDGLHQMVSPEKMSNEQKCQVNVCRALLK 1163 >Z54238-7|CAJ90498.1| 1861|Caenorhabditis elegans Hypothetical protein T28C6.9 protein. Length = 1861 Score = 27.1 bits (57), Expect = 8.7 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = +1 Query: 178 ISXEDQALELRRYFKSLGAEISEEKSPKGIEDDLHKIVGVCDACFKEPSESDIEAIL--N 351 +S EDQ LEL + + E+ +EK+ K D K+ + + + E D EA N Sbjct: 1256 LSLEDQNLELEERLQEMEEELLDEKNKKKEVD--AKVEQKSEENWGDWGEDDAEAATESN 1313 Query: 352 SIVSIMVSIPLERGENL 402 +VS + S E + L Sbjct: 1314 VVVSTLQSTVAELQDRL 1330 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,775,036 Number of Sequences: 27780 Number of extensions: 224757 Number of successful extensions: 723 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1091917214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -