BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0493 (554 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 1.4 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 23 2.4 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 21 5.5 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 7.2 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 21 7.2 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 23.4 bits (48), Expect = 1.4 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +1 Query: 265 YPEEDTPEEIIQRRGVVLSEL 327 YP E+ EE+ ++ G+ +S++ Sbjct: 257 YPSEEAKEELARKCGITVSQV 277 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.6 bits (46), Expect = 2.4 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 403 MRDPKTLINHLSTNKEYEFKIEMIDSM 483 + DP T L+TN+ YE + DS+ Sbjct: 144 LSDPNTNKLKLNTNESYELTVLKSDSL 170 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.4 bits (43), Expect = 5.5 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +2 Query: 473 SIACIVWPNIAMNVEIMWSQ 532 S+ +WP A E++WS+ Sbjct: 530 SVDTRLWPRAAALGEVLWSE 549 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.0 bits (42), Expect = 7.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 85 SNSC**SIFMNSYENGNTCSR 23 +NSC S F N+ + N C R Sbjct: 386 ANSCRSSTFRNNRDEYNVCFR 406 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.0 bits (42), Expect = 7.2 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -3 Query: 384 YIISLHESQYWLYCILKFLQFRKNYTSPLYNFFRS 280 Y + QY + L F +NY LYN F S Sbjct: 117 YAVYYWRQQYEDFWHRYTLSFIENYCQFLYNCFHS 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,176 Number of Sequences: 336 Number of extensions: 2408 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13725787 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -