BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0488 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8401| Best HMM Match : ig (HMM E-Value=8.1e-22) 31 0.62 SB_24994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 >SB_8401| Best HMM Match : ig (HMM E-Value=8.1e-22) Length = 965 Score = 31.5 bits (68), Expect = 0.62 Identities = 17/68 (25%), Positives = 32/68 (47%) Frame = +2 Query: 77 EEQKKNEIASFQHLSYYSPHDNLERKKYIYFRFISFLLTRV*NHNDSIEVSLQYILFTHK 256 + Q+K++ + +H+ Y+S +N Y + + FL R H D+ S + I Sbjct: 371 KRQEKSQKETGKHMDYFSDIENCSTDNYDWRLTVMFLFCRTLEHADNTGFSPEQIPMQGT 430 Query: 257 SFIFTLQN 280 SF + Q+ Sbjct: 431 SFNYQAQD 438 >SB_24994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 271 PPKFHFTPFGVIYPGSPTVAICP 339 P +F F+P+G + P SP CP Sbjct: 757 PNRFQFSPYGRVTPDSPGFIECP 779 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,682,313 Number of Sequences: 59808 Number of extensions: 446526 Number of successful extensions: 1068 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 932 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1068 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -