Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= P5PG0488
         (652 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g16095.1 68417.m02440 disease resistance protein-related cont...    28   6.2  

>At4g16095.1 68417.m02440 disease resistance protein-related
           contains weak similarity to rpp8 [Arabidopsis thaliana]
           gi|3901294|gb|AAC78631
          Length = 187

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 5/37 (13%)
 Frame = +3

Query: 276 KISFYPIWGNLPRFPDRCNMPS-----CITWCCMAND 371
           ++ F  +  ++PR PD+   P      C+ +CCM +D
Sbjct: 77  QLKFLTVGMHMPRLPDQHRFPPNLTNICLRYCCMEDD 113


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,876,624
Number of Sequences: 28952
Number of extensions: 324814
Number of successful extensions: 603
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 588
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 602
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1354097952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)