BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0486 (592 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 23 1.9 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 23 1.9 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 23 1.9 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 4.5 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 7.8 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 23.0 bits (47), Expect = 1.9 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -3 Query: 482 AVGSRHYCDTASSRTTPLSRVIAAGHQRGAGCELVPAITH 363 AVG R Y DT + T + AG Q + PA+ + Sbjct: 104 AVGVRIYVDTVINHMTGMGGTGTAGSQADRDGKNYPAVPY 143 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 23.0 bits (47), Expect = 1.9 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -3 Query: 482 AVGSRHYCDTASSRTTPLSRVIAAGHQRGAGCELVPAITH 363 AVG R Y DT + T + AG Q + PA+ + Sbjct: 105 AVGVRIYVDTVINHMTGMGGTGTAGSQADRDGKNYPAVPY 144 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 23.0 bits (47), Expect = 1.9 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -3 Query: 482 AVGSRHYCDTASSRTTPLSRVIAAGHQRGAGCELVPAITH 363 AVG R Y DT + T + AG Q + PA+ + Sbjct: 105 AVGVRIYVDTVINHMTGMGGTGTAGSQADRDGKNYPAVPY 144 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.8 bits (44), Expect = 4.5 Identities = 18/80 (22%), Positives = 36/80 (45%), Gaps = 3/80 (3%) Frame = -2 Query: 588 SNFIVLSSN-ISSMFMSFANQSHESLSSSTLKLVKEGGGFQTLL*HSIQSDHTFIEGNSC 412 S + SSN +S M +++ S +S ++ +G F + + +S + GN Sbjct: 10 STTMATSSNAMSPMTPTYSMNSMSCVSMPSMNCSPQGASFGSSMLNSGMPGGMAMNGNGM 69 Query: 411 RASAWCWV*VGS--GNNAQH 358 +S+ + +GS N +H Sbjct: 70 TSSSMGYTTIGSPISNRIRH 89 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.0 bits (42), Expect = 7.8 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 425 SIKVWSDWMLCHSSVWNPPPS 487 S++ +S W LC+S+ N P+ Sbjct: 361 SLRPFSRWSLCNSARSNKYPT 381 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,347 Number of Sequences: 336 Number of extensions: 3067 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -