BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0485 (436 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 26 0.21 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 4.5 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 6.0 AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding prote... 21 6.0 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 7.9 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 25.8 bits (54), Expect = 0.21 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 139 DKRLQEEL-NMLVDKLLGNEVDLYFPALQMLSNLIRT 246 D RL+ + N+ + G+ VD+YF LSN+ RT Sbjct: 676 DARLRNTMENLTCATVKGSAVDMYFRRQVELSNMYRT 712 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 4.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 298 HYPALKQVYEKITDEKT 348 HYP L +Y TD+K+ Sbjct: 1469 HYPDLHNLYAVPTDKKS 1485 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/28 (35%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +1 Query: 289 LREHYPALKQVYEKITDEKTKKF--CAD 366 LRE+YP+++ + E+ KK+ C D Sbjct: 192 LREYYPSVEWDILGVPAERHKKYYPCCD 219 >AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 310 LKQVYEKITDEKTKKF 357 LK +YE ++E+ KKF Sbjct: 37 LKSMYEANSEEQMKKF 52 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +1 Query: 262 TSVPKPLKFLREHYPALKQVYEKITD 339 +S P+P L++ YP + KI + Sbjct: 28 SSSPRPKPLLKKEYPLVMDTKLKIIE 53 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,758 Number of Sequences: 438 Number of extensions: 1377 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11368164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -