BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0483 (301 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_1063 + 30048724-30048753,30049036-30049175,30049282-300493... 27 3.6 >03_05_1063 + 30048724-30048753,30049036-30049175,30049282-30049336, 30049419-30049526,30050190-30050288,30050380-30050457, 30050558-30050635,30051875-30051949,30052117-30052217, 30052502-30052527,30053224-30053297,30053358-30053379, 30054108-30054223,30054361-30054618,30054716-30054832, 30055649-30055699,30055859-30056086,30056550-30056648, 30056823-30056999,30057298-30057417 Length = 683 Score = 26.6 bits (56), Expect = 3.6 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -3 Query: 131 LIHRHRESNARSDSSQSTHNYVPSKTILKKKTFVPRAEFLQ 9 LI RHR S++ ++ S N + + + T R++FL+ Sbjct: 491 LIRRHRHSDSTGSTTSSRSNPMREDMLNRSNTHRARSQFLE 531 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,584,162 Number of Sequences: 37544 Number of extensions: 93501 Number of successful extensions: 180 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 180 length of database: 14,793,348 effective HSP length: 71 effective length of database: 12,127,724 effective search space used: 339576272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -