BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0482 (593 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC110.01 |ppk1|SPAC140.05|serine/threonine protein kinase Ppk1... 26 3.6 SPBC1A4.03c |top2|ptr11|DNA topoisomerase II|Schizosaccharomyces... 25 8.3 SPAC3H5.06c |pol1|swi7, polA|DNA polymerase alpha catalytic subu... 25 8.3 >SPAC110.01 |ppk1|SPAC140.05|serine/threonine protein kinase Ppk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1023 Score = 26.2 bits (55), Expect = 3.6 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +1 Query: 4 IPRLQEFGTRE-LVSKHRQSLINNKYNVDCKQYYSTNKYLIFTKISSYNF*DISHNS 171 IP ++ TRE L+ + S ++NK N+D K + N KIS F +IS NS Sbjct: 222 IPSKEDLETREVLLLPPQTSKLSNK-NLDTKSFTDVN------KISQQGFVEISSNS 271 >SPBC1A4.03c |top2|ptr11|DNA topoisomerase II|Schizosaccharomyces pombe|chr 2|||Manual Length = 1485 Score = 25.0 bits (52), Expect = 8.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 322 THVNYGSYKVRCAICRTIRKETSNA 248 THVNY + K+ AI ++KE A Sbjct: 370 THVNYVANKIVDAIDEVVKKENKKA 394 >SPAC3H5.06c |pol1|swi7, polA|DNA polymerase alpha catalytic subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 1405 Score = 25.0 bits (52), Expect = 8.3 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 447 DRKKCYAVKLAEQKRQWKQNWPIVSNTRRA 536 D + CY+V L+ K + NW + RR+ Sbjct: 625 DFEMCYSVLLSRLKERKIHNWSSIGRLRRS 654 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,307,526 Number of Sequences: 5004 Number of extensions: 44402 Number of successful extensions: 104 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 258201856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -