BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0482 (593 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ150101-1|AAZ77787.1| 386|Caenorhabditis elegans synthetic mul... 31 0.47 AF025452-10|AAB70947.2| 386|Caenorhabditis elegans Hypothetical... 31 0.47 >DQ150101-1|AAZ77787.1| 386|Caenorhabditis elegans synthetic multivulva protein LIN-8 protein. Length = 386 Score = 31.5 bits (68), Expect = 0.47 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 85 DCKQYYSTNKYLIFTKISSYNF*DISHNSYTLKRQLL 195 D +Y+ST KY+ +K + F D N TLK+ +L Sbjct: 33 DPTRYFSTEKYIALSKDEKFKFDDYDVNDETLKKVVL 69 >AF025452-10|AAB70947.2| 386|Caenorhabditis elegans Hypothetical protein B0454.1 protein. Length = 386 Score = 31.5 bits (68), Expect = 0.47 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 85 DCKQYYSTNKYLIFTKISSYNF*DISHNSYTLKRQLL 195 D +Y+ST KY+ +K + F D N TLK+ +L Sbjct: 33 DPTRYFSTEKYIALSKDEKFKFDDYDVNDETLKKVVL 69 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,032,982 Number of Sequences: 27780 Number of extensions: 255831 Number of successful extensions: 680 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1258229602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -