BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0475 (441 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 24 2.1 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 6.4 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 22 8.4 AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like pepti... 22 8.4 AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like pepti... 22 8.4 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 22 8.4 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 24.2 bits (50), Expect = 2.1 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 145 QSILEEKLYPQSLNLNEIQKFA-EEHYILGKDND 243 + IL K+ P + QKF EEHYI DND Sbjct: 138 RKILRRKMLPYAR-----QKFGDEEHYIFQHDND 166 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 22.6 bits (46), Expect = 6.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 148 SILEEKLYPQSLNLNEIQKFAEE 216 SILEEKL NL+ I +F ++ Sbjct: 1073 SILEEKLNANKPNLSVIDEFLKK 1095 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/16 (62%), Positives = 11/16 (68%), Gaps = 1/16 (6%) Frame = +1 Query: 199 QKFA-EEHYILGKDND 243 Q+F EEHYI DND Sbjct: 223 QQFGDEEHYIFQHDND 238 >AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 22.2 bits (45), Expect = 8.4 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -1 Query: 441 SKCCHSSCTTPTI 403 ++CC+ SCT T+ Sbjct: 135 AECCYQSCTLDTL 147 >AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 22.2 bits (45), Expect = 8.4 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -1 Query: 441 SKCCHSSCTTPTI 403 ++CC+ SCT T+ Sbjct: 135 AECCYQSCTLDTL 147 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 22.2 bits (45), Expect = 8.4 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -1 Query: 441 SKCCHSSCTTPTI 403 ++CC+ SCT T+ Sbjct: 136 AECCYQSCTLDTL 148 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 446,107 Number of Sequences: 2352 Number of extensions: 8715 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36993357 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -