BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0472 (398 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 25 1.3 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 24 1.8 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 24 1.8 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 24 1.8 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 3.1 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 4.1 AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility pro... 23 4.1 AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility pro... 23 4.1 AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility pro... 23 4.1 AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility pro... 23 4.1 AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility pro... 23 4.1 AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility pro... 23 4.1 AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility pro... 23 4.1 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 23 5.4 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 5.4 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 5.4 CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 22 7.2 AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal prot... 22 9.5 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 24.6 bits (51), Expect = 1.3 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +2 Query: 8 NSFARFQRHTRPAHLHHAGRHHGSEH 85 N Q H + HL H +HH S H Sbjct: 114 NLLNHHQHHHQHPHLPHVQQHHPSVH 139 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.2 bits (50), Expect = 1.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 47 HLHHAGRHHGSEHSEIQSQTTFSELQIED*F 139 H HH+ HH +SQ E+Q D F Sbjct: 27 HRHHSRHHHRRRRERYRSQRFGYEIQNVDEF 57 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.2 bits (50), Expect = 1.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 47 HLHHAGRHHGSEHSEIQSQTTFSELQIED*F 139 H HH+ HH +SQ E+Q D F Sbjct: 27 HRHHSRHHHRRRRERYRSQRFGYEIQNVDEF 57 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.2 bits (50), Expect = 1.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 47 HLHHAGRHHGSEHSEIQSQTTFSELQIED*F 139 H HH+ HH +SQ E+Q D F Sbjct: 27 HRHHSRHHHRRRRERYRSQRFGYEIQNVDEF 57 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 3.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 26 QRHTRPAHLHHAGRHHGSEHSEIQ 97 Q+H + HH HH HS+ Q Sbjct: 175 QQHPGHSQHHHHHHHHHPHHSQQQ 198 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 4.1 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 Query: 26 QRHTRPAHLHHAGRHHGSEHS 88 Q+H H G+HH HS Sbjct: 645 QQHQHHQAHQHQGQHHAQHHS 665 >AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 21 HVLLYPGFQFRTNRLVHKLVELVLHFLP 48 >AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 21 HVLLYPGFQFRTNRLVHKLVELVLHFLP 48 >AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 23 HVLLYPGFQFRTNRLVHKLVELVLHFLP 50 >AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 23 HVLLYPGFQFRTNRLVHKLVELVLHFLP 50 >AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 4.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 99 HKLRFPNFKSRTNSIIQRNFFFENHKMP 182 H L +P F+ RTN ++ + H +P Sbjct: 24 HVLLYPGFQFRTNRLVHKLVELVLHFLP 51 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 22.6 bits (46), Expect = 5.4 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 152 PLDYRISPRFEVRKT*FVIVSRSARFRG 69 P D R+ PR+ +R F +SA+ G Sbjct: 81 PADCRLPPRWTIRNDTFRPFQQSAKLAG 108 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.6 bits (46), Expect = 5.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 66 GTTEASTPRYNHKLRFPNFKSR 131 GT +PR+ H+ R NF+ + Sbjct: 501 GTLGVQSPRHGHESRANNFRRK 522 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 22.6 bits (46), Expect = 5.4 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 Query: 32 HTRPAHLHHAGRHH 73 H P H HH HH Sbjct: 499 HAHPHHHHHHHHHH 512 Score = 21.8 bits (44), Expect = 9.5 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 Query: 32 HTRPAHLHHAGRHH 73 H+ AH HH HH Sbjct: 496 HSHHAHPHHHHHHH 509 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 22.2 bits (45), Expect = 7.2 Identities = 14/50 (28%), Positives = 19/50 (38%) Frame = -1 Query: 197 NFGFDGHLMIFKKKIPLDYRISPRFEVRKT*FVIVSRSARFRGADLRDAD 48 NFG DG++ K I I K F+ + + G RD D Sbjct: 369 NFGLDGYVEATKHIIDTTRYIEQELRAIKNIFIFGTPATSVIGIGSRDFD 418 >AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal protein rpL7a protein. Length = 271 Score = 21.8 bits (44), Expect = 9.5 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +3 Query: 330 ISQSIQPQRDIDR 368 I Q++QP+RD+ R Sbjct: 47 IGQNVQPKRDLSR 59 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 370,028 Number of Sequences: 2352 Number of extensions: 5671 Number of successful extensions: 73 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -