BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0471 (591 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1718.04 |||glycerol-3-phosphate O-acyltransferase |Schizosac... 28 0.89 SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces p... 25 6.2 SPBC887.11 |pus2||tRNA pseudouridylate synthase Pus2 |Schizosacc... 25 6.2 >SPBC1718.04 |||glycerol-3-phosphate O-acyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 675 Score = 28.3 bits (60), Expect = 0.89 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 380 HKINKLYHITFIPLLSLIYLCDCNFFLISYKAF*GLIV 493 H++ L + F+ L L+Y C C FL++ A G I+ Sbjct: 374 HQVQSLQYSRFMILYKLVYRC-CKLFLLALGALPGAIL 410 >SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces pombe|chr 2|||Manual Length = 752 Score = 25.4 bits (53), Expect = 6.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 400 SYHLHPTPVFNLPV*LQF 453 S+ LHP P+ LPV QF Sbjct: 485 SHPLHPPPILGLPVPAQF 502 >SPBC887.11 |pus2||tRNA pseudouridylate synthase Pus2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 451 Score = 25.4 bits (53), Expect = 6.2 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 546 NLSRKLQNSTERNL 587 NLSRKL N ERNL Sbjct: 182 NLSRKLDNELERNL 195 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,317,051 Number of Sequences: 5004 Number of extensions: 44701 Number of successful extensions: 85 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 256184654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -